DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7148 and AT4G30640

DIOPT Version :10

Sequence 1:NP_649366.1 Gene:CG7148 / 40432 FlyBaseID:FBgn0046301 Length:454 Species:Drosophila melanogaster
Sequence 2:NP_567849.1 Gene:AT4G30640 / 829187 AraportID:AT4G30640 Length:301 Species:Arabidopsis thaliana


Alignment Length:158 Identity:40/158 - (25%)
Similarity:65/158 - (41%) Gaps:34/158 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 LELMK---EFKA-QTIDTNGVIERIKVLFKG--YRDLL--LGFNTFLPKGYKITLLPEEEKPKIR 163
            ||:||   :.|. |:|.....|||:....:|  ...||  |.:..::|. |.::.|||..|..: 
plant   147 LEMMKRAADLKVLQSIMLFPTIERMAQSPQGKIMTPLLCSLRYVFYMPL-YLLSFLPENLKTSL- 209

  Fly   164 VDFKDAIGFVTK-IKTRFGDDEHAYKRFLDILNLYRKE---------KKSISEVYEEVTMLFKGH 218
                  :.||.: ||:   .||.:.:.   .|||:|.:         .:.:.:|.|......|.:
plant   210 ------VRFVLRGIKS---VDEASVEA---CLNLFRMDCAANAMYMGSQEMVKVLERDNNTIKRN 262

  Fly   219 EDLLMEFVNFLPN-CP-ESAPSTKNAVP 244
            ...|:.:.....| || :.....|.|.|
plant   263 LQKLIFYYGATDNWCPVQYYEEMKKAFP 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7148NP_649366.1 F-box_SF 9..47 CDD:459239
leucine-rich repeat 333..358 CDD:275381
AT4G30640NP_567849.1 AMN1 <101..>179 CDD:187754 11/31 (35%)
leucine-rich repeat 103..125 CDD:275381
leucine-rich repeat 126..151 CDD:275381 2/3 (67%)
leucine-rich repeat 152..177 CDD:275381 6/24 (25%)
leucine-rich repeat 178..223 CDD:275381 14/55 (25%)
leucine-rich repeat 224..248 CDD:275381 4/26 (15%)
leucine-rich repeat 249..274 CDD:275381 4/24 (17%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.