DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7148 and AT4G05470

DIOPT Version :9

Sequence 1:NP_649366.1 Gene:CG7148 / 40432 FlyBaseID:FBgn0046301 Length:454 Species:Drosophila melanogaster
Sequence 2:NP_001319875.1 Gene:AT4G05470 / 825897 AraportID:AT4G05470 Length:306 Species:Arabidopsis thaliana


Alignment Length:398 Identity:83/398 - (20%)
Similarity:120/398 - (30%) Gaps:176/398 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SLILQLDDDCLAEIFDRLQDLPSEVSFARTCRRVQYICLSKWRTSHAYEQLDLEKWRVLLPNHED 71
            |::|:|.   |.:|.|..|         :.|:..:.||            .|...||.:  |..|
plant    56 SILLRLS---LTDILDNAQ---------KVCKEWRRIC------------KDPSMWRKI--NTRD 94

  Fly    72 -LVY---FLTQMRPYIREMGGSSCLCSILKDLDEMHIAELPMVTSFYYDPDGVDCYPTNRSIRKL 132
             |:|   |::              :|..:.||.:..:.|:.:...|.  .|.:..|.|:|| |.|
plant    95 CLMYNFDFVS--------------MCRHIVDLSQGGLLEINVDEHFL--SDSLLSYITDRS-RNL 142

  Fly   133 ARL-----LPGLKKLRLTTPIDGRYLSNFQHLQELHLYEDQHKAFELQQKYLDEVCRTLHDLRVL 192
            ..|     .|.:.||.:...|        ..:..|...|..|...:|..|.:...|         
plant   143 RSLGLGMCFPRVTKLGVVNAI--------AKIPLLETLEVTHSCIKLDLKAIGHAC--------- 190

  Fly   193 DIRTYDMISKLQLGNCLQSFKNLTDLKLNLATLKPILPAVLELPSLRKLVVLLDNEWHIPPLVSP 257
                                ..|..||||               ||.:|       |     .:.
plant   191 --------------------PQLKTLKLN---------------SLGRL-------W-----PAS 208

  Fly   258 DSYDHKIREVSEFYEIMAFKAKDIVGFAVDGYYMPLEPGWD-----EKLPIWTHRRLKRLAICSW 317
            |.||..:              .|.:|        |||...|     |.:|...|           
plant   209 DKYDSNV--------------LDDMG--------PLECDDDALAIAESMPKLHH----------- 240

  Fly   318 THSADYLKRYTCMTELQLLCVRNWNDLSDEILLEFVELCPRLEHLDVSYC--RNLTPTFLPRALS 380
                           |||:.    |.|::..|...::.||.||||||..|  .:|......|.|.
plant   241 ---------------LQLMA----NRLTNTGLNAILDGCPHLEHLDVRKCFRISLVGNLEKRCLE 286

  Fly   381 ILKR-REP 387
            ::|. |.|
plant   287 MIKELRRP 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7148NP_649366.1 leucine-rich repeat 333..358 CDD:275381 7/24 (29%)
AT4G05470NP_001319875.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1046098at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.