DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7148 and VFB2

DIOPT Version :9

Sequence 1:NP_649366.1 Gene:CG7148 / 40432 FlyBaseID:FBgn0046301 Length:454 Species:Drosophila melanogaster
Sequence 2:NP_566928.1 Gene:VFB2 / 824170 AraportID:AT3G50080 Length:522 Species:Arabidopsis thaliana


Alignment Length:444 Identity:94/444 - (21%)
Similarity:162/444 - (36%) Gaps:146/444 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LDDDCLAEIFDRLQDLPSEVSFARTCRRVQYICLSKW-----RTSHAYEQLDLEKWRVLLP---- 67
            |.|||||.||..|     .....:.|..|.    .:|     :..|   :|.|:....:||    
plant    44 LPDDCLAHIFQFL-----SAGDRKRCSLVS----KRWLLVDGQNRH---RLSLDAKSEILPFLPC 96

  Fly    68 --NHEDLV-----------YFLTQMRPYIREMGGSSCL------CSILKDLDEMHIAELPMVTSF 113
              |..|.|           :.|:....:|..:..|:.:      |..:.||              
plant    97 IFNRFDSVTKLALRCDRRSFSLSDEALFIVSIRCSNLIRVKLRGCREITDL-------------- 147

  Fly   114 YYDPDGVDCYPTN-RSIRKLA--RLLPGLKKLRLTTPIDGRYLSNFQHLQELHL--YEDQHKAFE 173
                 |::.:..| :|:|||:  ....|.|.:       ...|.:.:.|:||.|  ....|:..|
plant   148 -----GMESFARNCKSLRKLSCGSCTFGAKGI-------NAMLEHCKVLEELSLKRIRGLHELAE 200

  Fly   174 ---------LQQKYLDEV-----------CRTLHDLRVLD-IRTYDMISKLQLGNCLQSFKNL-- 215
                     |:..:|.|:           .|||..::::. :..:|.:.::. ||...|...:  
plant   201 PIKLSLSASLRSVFLKELVNGQVFGSLVATRTLKKVKIIRCLGNWDRVFEMN-GNGNSSLTEIRL 264

  Fly   216 -----TDLKL-------NLATLKPI---------LPAVLE-LPSLRKLVVLLDNEWHIPPLVSPD 258
                 ||:.|       ||.||..:         |.:|:| ...||||.:   :.|.:..:    
plant   265 ERLQVTDIGLFGISKCSNLETLHIVKTPDCSNLGLASVVERCKLLRKLHI---DGWRVKRI---- 322

  Fly   259 SYDHKIREVSEFYEIMAFKAKDIVGFAVDGYYMPLEPGWDEKLPIWTH-RRLKRLAICSWTHSAD 322
             .|..:..|::.    ....:::|...||..||.|.       .|.:: ::|:|||:|......|
plant   323 -GDQGLMSVAKH----CLNLQELVLIGVDATYMSLS-------AIASNCKKLERLALCGSGTIGD 375

  Fly   323 YLKRYTCMTE----LQLLCVRNWNDLSDEILLEFVEL-CPRLEHLDVSYCRNLT 371
              ....|:.|    |:..|::..  |..::.::.:.| ||:|..|.|..|..:|
plant   376 --AEIGCIAEKCVTLRKFCIKGC--LISDVGVQALALGCPKLVKLKVKKCSLVT 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7148NP_649366.1 leucine-rich repeat 333..358 CDD:275381 5/25 (20%)
VFB2NP_566928.1 F-box-like 42..>71 CDD:403981 11/35 (31%)
AMN1 <119..>187 CDD:187754 15/93 (16%)
leucine-rich repeat 133..158 CDD:275381 5/43 (12%)
leucine-rich repeat 159..183 CDD:275381 6/30 (20%)
leucine-rich repeat 233..258 CDD:275381 4/25 (16%)
leucine-rich repeat 259..282 CDD:275381 3/22 (14%)
AMN1 263..>410 CDD:187754 36/169 (21%)
leucine-rich repeat 283..308 CDD:275381 6/24 (25%)
leucine-rich repeat 309..336 CDD:275381 7/38 (18%)
leucine-rich repeat 337..361 CDD:275381 7/30 (23%)
leucine-rich repeat 362..387 CDD:275381 8/26 (31%)
leucine-rich repeat 388..412 CDD:275381 5/25 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1046098at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.