DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7148 and Fbxo39

DIOPT Version :9

Sequence 1:NP_649366.1 Gene:CG7148 / 40432 FlyBaseID:FBgn0046301 Length:454 Species:Drosophila melanogaster
Sequence 2:XP_006533964.2 Gene:Fbxo39 / 628100 MGIID:3505735 Length:480 Species:Mus musculus


Alignment Length:270 Identity:61/270 - (22%)
Similarity:100/270 - (37%) Gaps:79/270 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MASEPRSLILQLDDDCLAEIFDRLQDLPSEVSFARTCRRVQYICLSKWRTSHAYEQLDL----EK 61
            ||:......|.|:.:|::   |.|.:..|| :.|.|.|.:...|       |.::....    ..
Mouse   257 MATFRNLTFLTLNYNCIS---DELLETLSE-NNAGTLRTMNIKC-------HVHDPHGQVVWGMS 310

  Fly    62 WRVLLPNHEDLV--YFLTQMRPYIREMGGSSCLCSILKDLDEMHIAELPMVTSFYYDPDGVDCYP 124
            |..|.....:|.  :|..::..|.|       |..||  |.|:.:..:.:.:.::.|||. ...|
Mouse   311 WAKLARQASNLKVNFFFERVMKYER-------LARIL--LQEIPVRSISLRSCYFSDPDW-SMRP 365

  Fly   125 TNRSIRKLARLLPGLKKLRLTTPIDGRYLSNFQHLQELHL-YEDQHKAFELQQKYLDEVCRTLHD 188
            |      |..|||..:..                ||:|.. :.:.|::.:.|...|...||.|..
Mouse   366 T------LTDLLPTFRNT----------------LQKLTFEFNNNHESLDEQLHLLILACRKLFY 408

  Fly   189 LRV---LDIRTYDMISKLQ-LGNCLQSFKNLTDLKLNL-----------ATLKPILPAVLELPSL 238
            .::   ||::..:.|.|.| .|.|     :|..||:.:           .||:.|         .
Mouse   409 FKIWAFLDVKFVERILKSQEEGQC-----SLHTLKVRIYTNRYETNEEDRTLREI---------Y 459

  Fly   239 RKLVVLLDNE 248
            ||...|:|:|
Mouse   460 RKYRKLIDSE 469

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7148NP_649366.1 leucine-rich repeat 333..358 CDD:275381
Fbxo39XP_006533964.2 F-box-like 53..94 CDD:372399
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1046098at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.