DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7148 and CG14317

DIOPT Version :9

Sequence 1:NP_649366.1 Gene:CG7148 / 40432 FlyBaseID:FBgn0046301 Length:454 Species:Drosophila melanogaster
Sequence 2:NP_650675.1 Gene:CG14317 / 42161 FlyBaseID:FBgn0038566 Length:448 Species:Drosophila melanogaster


Alignment Length:498 Identity:117/498 - (23%)
Similarity:215/498 - (43%) Gaps:114/498 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SLILQLDDDC------------------LAEIFDRLQDLPSEVSFARTCRRVQYICLSKWRTSHA 53
            :|:.|.::.|                  ..:||:.:.:|..:|..||...:.....|..|:    
  Fly    13 ALVAQQNNTCSPMEEIEPNYIDNLHIIFFEQIFEEIDNLIDQVRMARAYPQFMPQILKFWQ---- 73

  Fly    54 YEQLDLEKWRVLLPNH--------EDLVYFLTQMRPYIREM------GGSSCLCSILKDLDEMHI 104
             .:|.|    ::.||.        :|.|:|:..|.....::      |..|.....:..|.:::|
  Fly    74 -RRLHL----IIGPNTPFLGLLDIDDYVFFMEHMADSFTDLHVHDGVGSFSEFYDYITHLCDINI 133

  Fly   105 AELPMVTSFYY--DPDGVDCYPTNRSIRKLARLLPGLKKLRLTTPIDGRYLSNFQHLQELHLYED 167
            .:.|.|.:...  :|:.|    .:..||.|..:||.||:|.....:.|.|:..|:.|:|| ::..
  Fly   134 TKFPKVDTCILAGNPNTV----VDEDIRDLTVMLPNLKRLMTCMNLSGLYMRGFKKLEEL-VFNS 193

  Fly   168 QHKAFELQQKYLDEVCRTLHDLRVLDIRTYDMISKLQLGNCLQ----SFKNLTDLKLNLATLKPI 228
            .:.:..|..:::.::|.|:.:||||||..       |..:|::    ...||..||:||:|::.:
  Fly   194 LYHSVPLDSRWIQDICLTMTNLRVLDITD-------QFDSCVRLTDIKLPNLEVLKINLSTVECM 251

  Fly   229 LPAVLELPSLRKLVVLLDNEWHIPPLVSPDSYDHKIREVSEFYEIMAFKAKDIVGFAVDGYYMPL 293
            |..||:||.|:||.|..|           ||......:.:.|.:|:..|::.|...|::...:.|
  Fly   252 LSEVLQLPKLQKLSVRFD-----------DSRQLNADQETIFQQIVVAKSERITRIALNNEVVQL 305

  Fly   294 EPGWDE----KLPIWTHRRLKRLAICSWTHSADYLKR--YTCMTELQLLCVRNWNDLSDEILLEF 352
            ...|.:    :||     :|:::...:|.|:..:|.|  ..|. ::::|....|..:.:..|||.
  Fly   306 PARWQQSLLLELP-----KLRKVICENWCHNDFFLDRQHMPCQ-QMEVLSFSGWEIVRETQLLEL 364

  Fly   353 VELCPRLEHLDVS-YCRNLTPTFLPRALSILKRREPFKQKTGVGRSP-PLKLYYDLSGFEDFVDR 415
            |..|..||||.:: |..|...  |.:.::|..:.          |:| ||:::.|:. :.:|...
  Fly   365 VAECVNLEHLALNGYHSNWEK--LTKLVNIRNQE----------RNPRPLQVFSDMM-WGNFTPE 416

  Fly   416 ANLKSSLEY-----RGYIVFTADFPVDSERGLSFVDRGYQFEF 453
                   ||     ..|:..|.|   .||  ..:.:.|::|:|
  Fly   417 -------EYYHWQSNKYVQVTCD---SSE--YEYQEDGFEFDF 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7148NP_649366.1 leucine-rich repeat 333..358 CDD:275381 7/24 (29%)
CG14317NP_650675.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447172
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0016901
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.