DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7148 and CG14102

DIOPT Version :9

Sequence 1:NP_649366.1 Gene:CG7148 / 40432 FlyBaseID:FBgn0046301 Length:454 Species:Drosophila melanogaster
Sequence 2:NP_649147.2 Gene:CG14102 / 40156 FlyBaseID:FBgn0036906 Length:441 Species:Drosophila melanogaster


Alignment Length:429 Identity:88/429 - (20%)
Similarity:138/429 - (32%) Gaps:149/429 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MASEPRSL-----ILQLDDDCLAEIFDRLQDLPSEVSFARTCRRVQYICLSKWRTSHAYEQLDLE 60
            :...|:|:     .|.|:.||..:||..:..|..:::..|.....|.:.....||.|....:.|.
  Fly    13 LVGRPQSMSGGPGFLDLNYDCYHQIFSYINVLEDQLNLGRAHPLFQVVLTDILRTRHKKINVRLL 77

  Fly    61 K----WRVLL------------PN---HEDLVYFLTQMRPYIREMGGSSCLCSIL---------- 96
            |    |..||            |:   .|...|      |::..:|..   |..|          
  Fly    78 KTIPDWEFLLQLCGSEVSRCEVPHGSWDEPFTY------PFLGLLGRH---CPKLRQAVIIFMHA 133

  Fly    97 ------KDLDEMHI----AELPMVTSF--------------------YYDPDGVDCYPTNRSIRK 131
                  |..|..||    .|||.:|:.                    ..|.||:|...:|.|.::
  Fly   134 VTESPPKSGDRGHIMQLLLELPSLTNLTLIDARSAQLDQLRHFSKLEALDLDGIDPNLSNASFQQ 198

  Fly   132 LARLLPGLKKLRLTTPIDGRYLSNFQHLQELHLYEDQHKAFELQQKY--LDEVCRTLHDLRVLDI 194
            :...:..||:|.|....|.|               ..|:...|..|:  ||.          |.:
  Fly   199 MFESMASLKRLLLNFGPDRR---------------RSHQVPLLADKFPNLDH----------LTL 238

  Fly   195 RTYDMISKLQLGNCLQSFKNLTDLKLNLATLKPILPAVLELPSLRKLVVLLDNEWHIPPLVSPDS 259
            ..:|| |..:||    .||.|..|:|                 :.:....:||          |.
  Fly   239 ENFDM-SFPELG----EFKGLRSLRL-----------------ISRWTAEVDN----------DF 271

  Fly   260 YDHKIREVSEFYEIMAFKAKDIVGFAVDGYYMPLEPGWDEKLPIWTHRRLKRLAICSW-THSADY 323
            |....:.||...::      .::...|.|         |:...|...|:|..|...:| ..|...
  Fly   272 YRSVAKRVSNLQKL------QLISVRVRG---------DQVHHILAIRQLNALDCDNWPAQSVSQ 321

  Fly   324 LKRYTCMTELQLLCVRNWNDLSDEILLEFVELCPRLEHL 362
            |.:...:..|.|.|:.:..:.|.:::| .|:.|..|.||
  Fly   322 LGQLKDLECLALDCIDSPANPSRQLML-LVQNCYNLNHL 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7148NP_649366.1 leucine-rich repeat 333..358 CDD:275381 7/24 (29%)
CG14102NP_649147.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0016901
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.