DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7148 and fbxa-219

DIOPT Version :9

Sequence 1:NP_649366.1 Gene:CG7148 / 40432 FlyBaseID:FBgn0046301 Length:454 Species:Drosophila melanogaster
Sequence 2:NP_001022910.1 Gene:fbxa-219 / 3565143 WormBaseID:WBGene00044403 Length:291 Species:Caenorhabditis elegans


Alignment Length:311 Identity:63/311 - (20%)
Similarity:121/311 - (38%) Gaps:98/311 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   181 EVCRTLHD-LRVLDIRTYDMIS--------KLQLGNCLQSFKNL-----TDLKLNLATLKPILPA 231
            :||::|.. :..:.| .:|.|:        |:.:.|.:..:.|.     |:.|..:.|...:..|
 Worm    34 KVCKSLRTAIDTIGI-NFDSITFEVEDDYVKIIIKNLIIHYTNSEIAVDTEKKKIIKTQDFMERA 97

  Fly   232 VLELPSL---RKLVVLLDNEWH--IPPLV-----SPDSYDHKI----REVSEFYEIMA-FKAKDI 281
            :.:|.:|   .|::.:::.|:|  :.||:     ....:.|:|    ..:||...|:. |.||.:
 Worm    98 LKDLGTLIKYAKMLRIMEREFHEDVTPLLEVLESKKPLFAHQIILYAFRLSEIQSILPYFDAKSL 162

  Fly   282 VGFAVDGYYMPLEPGWDEKLPIWTHRRLKRLAICSWTHSADYLKRYTCMTE---LQLLCVR--NW 341
            .|..:  :.:|.||                       .|:.|.::.|.:.:   .:.|..|  ::
 Worm   163 TGIIL--WDIPEEP-----------------------DSSHYFEQITQLEQWKSAKFLLFRDFSF 202

  Fly   342 NDLSDEILLEFVELCPRLEHLDVSYCRNLTPTFLPRALSI---LKRREPFKQKTGVGRSPPLKLY 403
            ::|..|.|..|.:....||.|.:.:           |:.|   |.:|:.|::.|         ::
 Worm   203 DNLPFEQLFHFEKFIIELETLTIEH-----------AIKIRDDLMKRDTFRECT---------IW 247

  Fly   404 Y-DLSGFEDFVDRANLKSSLEYRGYIVFTADFPVDSERGLSFVDRGYQFEF 453
            : |...|::.     ....|..|    ||..|  :.|....|   ||:.||
 Worm   248 FKDNDSFDEI-----FSPELNER----FTIRF--EEEEDFEF---GYESEF 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7148NP_649366.1 leucine-rich repeat 333..358 CDD:275381 6/26 (23%)
fbxa-219NP_001022910.1 FBOX 12..52 CDD:197608 4/18 (22%)
FTH 125..260 CDD:366829 33/184 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1046098at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.