DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7148 and Fbxl12

DIOPT Version :9

Sequence 1:NP_649366.1 Gene:CG7148 / 40432 FlyBaseID:FBgn0046301 Length:454 Species:Drosophila melanogaster
Sequence 2:XP_006242701.1 Gene:Fbxl12 / 313782 RGDID:1305528 Length:326 Species:Rattus norvegicus


Alignment Length:299 Identity:78/299 - (26%)
Similarity:118/299 - (39%) Gaps:77/299 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 LKDLDEMHIAELPMVTSFYYDPDGVDCYPTNRSIRKLARLLPGLKKLRLTTPIDGRYLSNFQHLQ 160
            |.||.::.:.|:     |.|       .|....|| ::|:....|:|     :|.|:|  ::|: 
  Rat     4 LFDLPDLVLLEI-----FSY-------LPVRDRIR-ISRVCHRWKRL-----VDDRWL--WRHV- 47

  Fly   161 ELHLYEDQHKA-FELQQKYLDEVCRTLHDLRVLDIRTYDMISKLQLGNCL-----QSFKNLTDLK 219
            :|.||..:.|. :.|.::|:   ...||.|| :....:......||...|     |...||..|.
  Rat    48 DLTLYTMRPKVMWHLLRRYM---ASRLHSLR-MGGYLFSGSQAPQLSPALMRALGQKCPNLKRLC 108

  Fly   220 LNLATLK--PI--LPA---VLELPSLRKLVVLLDNEWHIPPLVSPDSYDHKIREVSEFYEIMAFK 277
            |::|.|.  ||  ||:   .|||.|....::.|..|.  .|.|.|      :.|......:.||:
  Rat   109 LHVADLSMVPITSLPSTLRTLELHSCEISMIWLQKEQ--DPTVLP------LLECIVLDRVPAFR 165

  Fly   278 AKDIVG---------FAVDGYYMPLEPGWDEKLPIWTHRRLKRLAICSWTHSADYLKRYTCMTEL 333
            .:.:.|         ..:.|.|...|.|.|..|...::  |:||.:...|.|||          .
  Rat   166 DEHLQGLTRFRALRSLVLGGTYRVTETGLDSSLQELSY--LQRLEVLGCTLSAD----------S 218

  Fly   334 QLLCV-RNWNDLSDEIL---------LEFVELCPRLEHL 362
            .||.: |:..|:....|         |.|:|..|.||.|
  Rat   219 TLLAISRHLRDVRKIRLTVGGLSAQGLVFLEGMPVLESL 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7148NP_649366.1 leucine-rich repeat 333..358 CDD:275381 8/34 (24%)
Fbxl12XP_006242701.1 F-box-like 4..48 CDD:403981 16/64 (25%)
leucine-rich repeat 104..125 CDD:275381 9/20 (45%)
AMN1 121..>226 CDD:187754 30/124 (24%)
leucine-rich repeat 126..152 CDD:275381 9/33 (27%)
leucine-rich repeat 153..177 CDD:275381 4/23 (17%)
leucine-rich repeat 178..203 CDD:275381 6/24 (25%)
leucine-rich repeat 204..229 CDD:275381 10/34 (29%)
leucine-rich repeat 230..253 CDD:275381 4/22 (18%)
leucine-rich repeat 254..283 CDD:275381 3/4 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1046098at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.