DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7148 and Fbxl12

DIOPT Version :9

Sequence 1:NP_649366.1 Gene:CG7148 / 40432 FlyBaseID:FBgn0046301 Length:454 Species:Drosophila melanogaster
Sequence 2:NP_001273458.1 Gene:Fbxl12 / 30843 MGIID:1354738 Length:349 Species:Mus musculus


Alignment Length:302 Identity:79/302 - (26%)
Similarity:116/302 - (38%) Gaps:81/302 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 IAELPMVTSFYYDPDGVDCYPTNRSIRKLARLLPGLKKLRLTTP-----------IDGRYLSNFQ 157
            :.|:|   |.:..|.|        |.|:.|||||....|....|           :|.|:|  ::
Mouse    17 VLEIP---SSWKKPKG--------SQRRGARLLPSQTILLPRNPGCRVCHRWKRLVDDRWL--WR 68

  Fly   158 HLQELHLYEDQHKA-FELQQKYLDEVCRTLHDLRVLDIRTYDMISKLQLGNCL-----QSFKNLT 216
            |: :|.||..:.|. :.|.::|:   ...|:.|| :....:......||...|     |...||.
Mouse    69 HV-DLTLYTMRPKVMWHLLRRYM---ASRLYSLR-MGGYLFSGSQAPQLSPALMRALGQKCPNLK 128

  Fly   217 DLKLNLATLK--PI--LPA---VLELPSLRKLVVLLDNEWHIPPLVSPDSYDHKIREVSEFYEIM 274
            .|.|::|.|.  ||  ||:   .|||.|....::.|..|.  .|.|.|      :.|......:.
Mouse   129 RLCLHVADLSMVPITSLPSTLRTLELHSCEISMIWLQKEQ--DPTVLP------LLECIVLDRVP 185

  Fly   275 AFKAKDIVG---------FAVDGYYMPLEPGWDEKLPIWTHRRLKRLAICSWTHSADYLKRYTCM 330
            ||:.:.:.|         ..:.|.|...|.|.|..|...::  |:||.:...|.|||        
Mouse   186 AFRDEHLQGLTRFRALRSLVLGGTYRVTETGLDASLQELSY--LQRLEVLGCTLSAD-------- 240

  Fly   331 TELQLLCV-RNWNDLSDEIL---------LEFVELCPRLEHL 362
              ..||.: |:..|:....|         |.|:|..|.||.|
Mouse   241 --STLLAISRHLRDVRKIRLTVGGLSAQGLVFLEGMPVLESL 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7148NP_649366.1 leucine-rich repeat 333..358 CDD:275381 8/34 (24%)
Fbxl12NP_001273458.1 F-box-like <51..73 CDD:289689 4/24 (17%)
leucine-rich repeat 127..148 CDD:275381 9/20 (45%)
AMN1 144..>249 CDD:187754 30/124 (24%)
leucine-rich repeat 149..175 CDD:275381 9/33 (27%)
leucine-rich repeat 176..200 CDD:275381 4/23 (17%)
leucine-rich repeat 201..226 CDD:275381 6/24 (25%)
leucine-rich repeat 227..252 CDD:275381 10/34 (29%)
leucine-rich repeat 253..276 CDD:275381 4/22 (18%)
leucine-rich repeat 277..306 CDD:275381 3/4 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1046098at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.