DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7148 and Amn1

DIOPT Version :9

Sequence 1:NP_649366.1 Gene:CG7148 / 40432 FlyBaseID:FBgn0046301 Length:454 Species:Drosophila melanogaster
Sequence 2:NP_001008334.2 Gene:Amn1 / 302032 RGDID:1308119 Length:258 Species:Rattus norvegicus


Alignment Length:286 Identity:50/286 - (17%)
Similarity:94/286 - (32%) Gaps:99/286 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 PTNRSIRKLARLLPGLKKLRLTTPIDGRYLSNFQHLQELHLYEDQHKAFELQQKYLD-EVCRTLH 187
            |::|.:.:|..|.     ||.......||:|:.::|.. ::.:...|...::.:..| .:...||
  Rat     2 PSSRVVSQLLELC-----LRCLIINISRYISDIKYLPP-NIKDRLIKIMSMRGRITDSNINEVLH 60

  Fly   188 DLRVLDIRTYDMISKLQLGNCLQSFKNLTDLKL-NLATLKPILPAVLELPSLRKLVVLLDNEWHI 251
                      ..:.:|.|.:|     |::|:.| :|...:.:  ..|.|.|.|            
  Rat    61 ----------PEVQRLDLRSC-----NISDVALQHLCKCRKL--KALNLKSCR------------ 96

  Fly   252 PPLVSPDSYDHKIREVSEFYEIMAFKAKDIVGFAVDGYYMPLEPGWDEKLPIWTHRRLKRLAICS 316
                     :|:....||..:.:|....|:...::.|                         .||
  Rat    97 ---------EHRNSITSEGIKAVASSCSDLHEISLKG-------------------------CCS 127

  Fly   317 WTHSADYLKRYTCMTELQLLCVRNWNDLSDEILLEFVELCP------------------------ 357
            .|..........|.. |:::.:.....::||.|....:.||                        
  Rat   128 VTDEGVLALALNCQL-LKIIDLGGCLSITDESLHALGKNCPFLQCVDFSTTQVSDNGVVALVSGP 191

  Fly   358 ---RLEHLDVSYCRNLTPTFLPRALS 380
               :||.:::.||.|||...:..||:
  Rat   192 CAKQLEEINMGYCINLTDKAVEAALT 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7148NP_649366.1 leucine-rich repeat 333..358 CDD:275381 6/51 (12%)
Amn1NP_001008334.2 leucine-rich repeat 10..35 CDD:275381 8/30 (27%)
leucine-rich repeat 36..58 CDD:275381 2/21 (10%)
AMN1 37..257 CDD:187754 40/245 (16%)
leucine-rich repeat 63..86 CDD:275381 7/27 (26%)
leucine-rich repeat 87..116 CDD:275381 8/51 (16%)
leucine-rich repeat 117..142 CDD:275381 5/49 (10%)
leucine-rich repeat 143..168 CDD:275381 5/24 (21%)
leucine-rich repeat 169..195 CDD:275381 0/25 (0%)
leucine-rich repeat 196..221 CDD:275381 9/22 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1046098at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.