DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7148 and FBXW8

DIOPT Version :9

Sequence 1:NP_649366.1 Gene:CG7148 / 40432 FlyBaseID:FBgn0046301 Length:454 Species:Drosophila melanogaster
Sequence 2:XP_016874665.1 Gene:FBXW8 / 26259 HGNCID:13597 Length:599 Species:Homo sapiens


Alignment Length:225 Identity:44/225 - (19%)
Similarity:72/225 - (32%) Gaps:93/225 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   185 TLHDLRVLDIRTYDMI-------------------------SKLQLGNCLQSFKNLTDLKLNL-- 222
            |..|:||.|.||:|.:                         |.|.:......|.|:.||:...  
Human   229 TSGDVRVWDTRTWDYVAPFLESEDEEDEPGMQPNVSFVRINSSLAVAAYEDGFLNIWDLRTGKYP 293

  Fly   223 -------ATLKPIL----PAVLELPSLRKLVVLLDNE---WHI------PPLVS-----PDSYDH 262
                   |.::.:.    .|.:...|...:|:|..||   |.|      |.||.     |::..:
Human   294 VHRFEHDARIQALALSQDDATVATASAFDVVMLSPNEEGYWQIAAEFEVPKLVQYLEIVPETRRY 358

  Fly   263 KIREVSEFYEIMAFKAKDI---------------------VGFAVDGYYMPLEPGW---DEKLPI 303
            .:...:....:...||:|.                     |.|.|.|.      ||   ..|:.:
Human   359 PVAVAAAGDLMYLLKAEDSARTLLYAHGPPVTCLDVSANQVAFGVQGL------GWVYEGSKILV 417

  Fly   304 WT---HRRLKRLAICSWTHSADYLKRYTCM 330
            ::   .|||.:|        .:.|:.:||:
Human   418 YSLEAGRRLLKL--------GNVLRDFTCV 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7148NP_649366.1 leucine-rich repeat 333..358 CDD:275381
FBXW8XP_016874665.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1046098at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.