DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7148 and FBXL2

DIOPT Version :9

Sequence 1:NP_649366.1 Gene:CG7148 / 40432 FlyBaseID:FBgn0046301 Length:454 Species:Drosophila melanogaster
Sequence 2:NP_001336245.1 Gene:FBXL2 / 25827 HGNCID:13598 Length:454 Species:Homo sapiens


Alignment Length:402 Identity:84/402 - (20%)
Similarity:149/402 - (37%) Gaps:138/402 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 SFARTCRRVQYI------------CLSKWRTSHAYEQLDLEKWRVLLPNHEDLVYFLTQMRPYIR 84
            :||:.||.::::            |.|..|.....:.|||... |.:.|               .
Human    98 TFAQNCRNIEHLNLNGCTKITDSTCYSLSRFCSKLKHLDLTSC-VSITN---------------S 146

  Fly    85 EMGGSSCLCSILKDLDEMHIAELPMVTSFYYDPDGVDCYPTNRSIRKLARLLPGLKKLRL--TTP 147
            .:.|.|..|   ::|:.::::....:|.     ||::.         |.|...|||.|.|  .|.
Human   147 SLKGISEGC---RNLEYLNLSWCDQITK-----DGIEA---------LVRGCRGLKALLLRGCTQ 194

  Fly   148 IDG---RYLSNFQH-LQELHLYEDQHKAFELQQKYLDEVCRTLHDLRVLDIRTYDMISKLQLGNC 208
            ::.   :::.|:.| |..|:|    .....:..:.:.::||..|.|:.|               |
Human   195 LEDEALKHIQNYCHELVSLNL----QSCSRITDEGVVQICRGCHRLQAL---------------C 240

  Fly   209 LQSFKNLTD-----LKLNLATLKPILPAV-------------------LELPSLRKLVVLLDN-- 247
            |....||||     |.||...|: ||.|.                   ||...|.:.:::.|:  
Human   241 LSGCSNLTDASLTALGLNCPRLQ-ILEAARCSHLTDAGFTLLARNCHELEKMDLEECILITDSTL 304

  Fly   248 ---EWHIPPLVSPDSYDHKIREVSEFYEIMAFKAKDIVGFAVDGYYMPLEPGWDEKLPIWTHRRL 309
               ..|.|.|.:                :::....||:      :.:.:      |.|...:::|
Human   305 IQLSIHCPKLQA----------------LVSLSFSDII------HLLKM------KEPSHHNKKL 341

  Fly   310 KRLAIC-SWTH----SAD---YLKRYTCMTE-LQLLCVRNWNDLSDEILLEFVELCPRLEHLDVS 365
            ...:.| |.:|    :.|   :|...||..| |::|.:.|...::| :.||.:|.|..||.|::.
Human   342 FGFSFCKSLSHCELITDDGILHLSNSTCGHERLRVLELDNCLLITD-VALEHLENCRGLERLELY 405

  Fly   366 YCRNLTPTFLPR 377
            .|:.:|...:.|
Human   406 DCQQVTRAGIKR 417

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG7148NP_649366.1 leucine-rich repeat 333..358 CDD:275381 8/24 (33%)
FBXL2NP_001336245.1 F-box-like 15..56 CDD:315592
leucine-rich repeat 52..79 CDD:275381
AMN1 <76..223 CDD:332986 32/161 (20%)