DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7407 and Mxra7

DIOPT Version :9

Sequence 1:NP_649364.1 Gene:CG7407 / 40430 FlyBaseID:FBgn0037134 Length:168 Species:Drosophila melanogaster
Sequence 2:XP_001074923.3 Gene:Mxra7 / 690599 RGDID:1594666 Length:173 Species:Rattus norvegicus


Alignment Length:113 Identity:37/113 - (32%)
Similarity:63/113 - (55%) Gaps:14/113 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 EPRDEEDSESRTPQGEETDDDEAYEENSTESEVELIEEQLPEHSYNHLMGQLKAKRLQHKMEKTL 119
            ||.:||      |:.|...|:::..|....:| |..||.....|:.:..|||:..  |:|  |.:
  Rat    73 EPEEEE------PEAEGRQDEDSDSEMGPPTE-EPEEEAGAAFSFKYSPGQLRGS--QYK--KMM 126

  Fly   120 TPSQIEEERRIEREQLAAIFELLRKQEAELNLQDRISDQDLKQQVRLY 167
            |..::|||:|:::|||.||.:|::..:....   .:||.|:::|:|||
  Rat   127 TKEELEEEQRVQKEQLTAILKLMKDNKDTFG---EMSDGDMQEQLRLY 171



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2E3A5
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007424
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR21845
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.870

Return to query results.
Submit another query.