DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7407 and Mxra7

DIOPT Version :9

Sequence 1:NP_649364.1 Gene:CG7407 / 40430 FlyBaseID:FBgn0037134 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_080556.1 Gene:Mxra7 / 67622 MGIID:1914872 Length:178 Species:Mus musculus


Alignment Length:179 Identity:52/179 - (29%)
Similarity:82/179 - (45%) Gaps:31/179 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LFLGLPGHYSVALVTLLLCVLVAFYFANIFKDKGELEDEGLGADEP------------------- 56
            |...||. ...||..||..:|:....|.:...:....||..||..|                   
Mouse     7 LLAALPA-LVTALALLLAWLLLRRGAARVPAPESTASDEAPGAPAPPEPPESCAPEPAPEGPSQS 70

  Fly    57 ---RDEEDSESRTPQGEETDDDEAYEENSTESEVELIEEQLPEHSYNHLMGQLKAKRLQHKMEKT 118
               .:.|:||:..|..|...|:::..|....:| |..||.....|:.:..|||:..  |:|  |.
Mouse    71 ERVAEPEESEAEEPAAEGRQDEDSDSEMGPPTE-EPEEEDGAAFSFKYSPGQLRGS--QYK--KM 130

  Fly   119 LTPSQIEEERRIEREQLAAIFELLRKQEAELNLQDRISDQDLKQQVRLY 167
            :|..::|||.|:::|||||||:|::..:....   .:||.|:::|:|||
Mouse   131 MTKEELEEEHRVQKEQLAAIFKLMKDNKDTFG---EMSDGDMQEQLRLY 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7407NP_649364.1 None
Mxra7NP_080556.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 33..126 20/95 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2E3A5
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007424
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR21845
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
65.870

Return to query results.
Submit another query.