| Sequence 1: | NP_649364.1 | Gene: | CG7407 / 40430 | FlyBaseID: | FBgn0037134 | Length: | 168 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_002935971.2 | Gene: | mxra7 / 594877 | XenbaseID: | XB-GENE-953446 | Length: | 211 | Species: | Xenopus tropicalis |
| Alignment Length: | 134 | Identity: | 43/134 - (32%) |
|---|---|---|---|
| Similarity: | 73/134 - (54%) | Gaps: | 17/134 - (12%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 44 GELEDEGL--GADEPRDEED--SESRTP-QGEETDDDEAYEENSTESE-----VELIEEQLPEHS 98
Fly 99 YNHLMGQLKAKRLQHKMEKTLTPSQIEEERRIEREQLAAIFELLRKQEAELNLQDRISDQDLKQQ 163
Fly 164 VRLY 167 |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 1 | 1.000 | - | - | FOG0007424 | |
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 1 | 1.000 | - | - | ||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 3 | 2.910 | |||||