DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7407 and C05G5.3

DIOPT Version :9

Sequence 1:NP_649364.1 Gene:CG7407 / 40430 FlyBaseID:FBgn0037134 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_510449.2 Gene:C05G5.3 / 181569 WormBaseID:WBGene00007349 Length:219 Species:Caenorhabditis elegans


Alignment Length:144 Identity:35/144 - (24%)
Similarity:65/144 - (45%) Gaps:19/144 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 ANIFKDKGELEDEGLGADEPRDEEDSESRTPQ--GEETDDDEAY--EENSTESEVELIEEQLPEH 97
            :|..||..|.:.|.....:.:||::.|.:.||  ..:..:.:.:  :|.||..|....:|.....
 Worm    80 SNSEKDNSEEKTESESETDEQDEDEEEEQMPQFNNRKITNTQNFCPDEPSTSQENPFAKELSDAD 144

  Fly    98 SYNHLMG---------QLKAKRLQHKMEKTLTPSQIEEERRIEREQLAAIFELLRKQEAELNLQD 153
            ..|..:|         |||||..|...|  ::..:.|.|.:::..|:.:|..|:.:.:.:..:  
 Worm   145 KMNVTIGKLHGKLATAQLKAKTRQIAAE--MSNEEKEYEAKMKNNQMESIMRLMMQNQEKFGM-- 205

  Fly   154 RISDQDLKQQVRLY 167
              |..|:|:|:.||
 Worm   206 --SSDDIKEQMNLY 217



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2E3A5
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR21845
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.960

Return to query results.
Submit another query.