DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LRPAP1 and CG8507

DIOPT Version :9

Sequence 1:NP_002328.1 Gene:LRPAP1 / 4043 HGNCID:6701 Length:357 Species:Homo sapiens
Sequence 2:NP_649950.1 Gene:CG8507 / 41205 FlyBaseID:FBgn0037756 Length:379 Species:Drosophila melanogaster


Alignment Length:388 Identity:124/388 - (31%)
Similarity:186/388 - (47%) Gaps:65/388 - (16%)


- Green bases have known domain annotations that are detailed below.


Human    15 ALLLLLLFLGPWPAASHGGKYSREKNQP--------KPSPKRESGEE-FRMEKLNQLWEKAQ-RL 69
            ||.:|:...|.........|||:|.|.|        |..|..:|.:. |||.|||.:|.||| ||
  Fly    12 ALSVLIALQGVDADKKQSKKYSKEANDPHFQQVKQEKYDPDFKSIQRPFRMAKLNLVWAKAQNRL 76

Human    70 HLPPVRLAELHADLKIQERDELAWKKLKLDGLDEDGEKEARLIRNLNVILAKYGL----DGKKDA 130
            ..|  :|..|:.:|||.:::|:|||:|.....|:||.|...|.|.|..|::.|.|    |..:|.
  Fly    77 TEP--KLKSLYMELKIHDKEEIAWKQLNSQHKDKDGLKADELRRKLIGIMSSYDLLEHFDDTQDT 139

Human   131 RQVTSNSLSGTQEDG------LDDPRLEKLWHKAKTSGKFSGEELDKLWREFLHHKEKVHEYNVL 189
            .::.........|:.      ..|.:|.:||.||:.|| |:.|||..|.:||.||::||..|..|
  Fly   140 EKLKPYKKFHDAEERHRNKSLFKDKKLNRLWEKAEISG-FTAEELKSLKQEFDHHQDKVDVYYSL 203

Human   190 LETLSRTE-EIHENVISPSDL------------SDIKG------------SVLHSRHTELKEKLR 229
            ||.:...: :.|||.|:..||            :|||.            :.|...||.:|:.  
  Fly   204 LENIGTVDTDKHENAINTEDLDTYNLISNDVNENDIKTHAQNVKSFENDLNTLRGHHTGIKDH-- 266

Human   230 SINQGLDRLRRVSHQGYSTEAEFEEPRVIDLWDLAQSANLTDKELEAFREELKHFEAKIEKHNHY 294
                 .|||.|:...|..:: :|.||:|..||.:||::|.|.||||:.:.||.|||:::.|..|.
  Fly   267 -----YDRLERLVSSGPHSQ-DFIEPKVQGLWRVAQASNFTVKELESIKTELHHFESRLLKLRHL 325

Human   295 QKQLEIAHEKLRHAESVGDGERVSRSREKHALLEGRTKELGYTVKKHLQDLSGRISRARHNEL 357
            ..:..:..||.:       ||:|.....:...:|.:.|:....|:|..:::...|  .:|.||
  Fly   326 HAEHALQKEKYK-------GEKVKDKSSRFEEMEDQLKKQTRKVEKLQENIEKTI--FKHTEL 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LRPAP1NP_002328.1 Alpha-2-MRAP_N 25..131 CDD:310769 44/119 (37%)
3-helical coiled coil 58..67 CDD:269813 5/8 (63%)
3-helical coiled coil 75..96 CDD:269813 9/20 (45%)
3-helical coiled coil 107..120 CDD:269813 5/12 (42%)
Alpha-2-MRAP_C 146..357 CDD:310770 73/235 (31%)
CG8507NP_649950.1 Alpha-2-MRAP_N 15..140 CDD:399416 46/126 (37%)
Alpha-2-MRAP_C 161..379 CDD:399417 73/235 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159136
Domainoid 1 1.000 99 1.000 Domainoid score I7125
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H37612
Inparanoid 1 1.050 148 1.000 Inparanoid score I4411
Isobase 1 0.950 - 0 Normalized mean entropy S5708
OMA 1 1.010 - - QHG49282
OrthoDB 1 1.010 - - D388256at33208
OrthoFinder 1 1.000 - - FOG0007150
OrthoInspector 1 1.000 - - oto89576
orthoMCL 1 0.900 - - OOG6_107561
Panther 1 1.100 - - LDO PTHR16560
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6462
SonicParanoid 1 1.000 - - X6028
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1514.890

Return to query results.
Submit another query.