DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycH and CCNT1

DIOPT Version :9

Sequence 1:NP_524207.1 Gene:CycH / 40429 FlyBaseID:FBgn0022936 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_001231.2 Gene:CCNT1 / 904 HGNCID:1599 Length:726 Species:Homo sapiens


Alignment Length:299 Identity:60/299 - (20%)
Similarity:109/299 - (36%) Gaps:75/299 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SQKRSWTFANEGQLMEFRVEQNS---KYIESHEEEAQGRDLNEHFLTSAEERLLLKQYEIYLFDF 67
            :..:.|.|..| ||      :||   ::....::|...|....:.|....:||.:.|        
Human     7 NNNKRWYFTRE-QL------ENSPSRRFGVDPDKELSYRQQAANLLQDMGQRLNVSQ-------- 56

  Fly    68 CRRFEPTMPKCVVGTAFHYFKRFYLNNSPMDYHPKEILATCVFVACKVEEFNVSINQFV------ 126
                      ..:.||..|..|||:..|...:....:....:|:|.||||....:...:      
Human    57 ----------LTINTAIVYMHRFYMIQSFTQFPGNSVAPAALFLAAKVEEQPKKLEHVIKVAHTC 111

  Fly   127 ----NNIKGDRNKA-----TDIVLSNELLLIGQLNYYLTIHNPFRPIEGFLIDIK-TRSNMQNPD 181
                .::...|::|     .|:|:. |.:::..|.:.|||.:|...:      :| |:....:.|
Human   112 LHPQESLPDTRSEAYLQQVQDLVIL-ESIILQTLGFELTIDHPHTHV------VKCTQLVRASKD 169

  Fly   182 RLRPHIDSFIDSTYYSDACLLHTPSQIALAAVLHAASREQ--------------ENLDSYVT-DL 231
            ..:.......:|.:.:...|.:||..:|...: |.|.:..              |.:|:.|| :|
Human   170 LAQTSYFMATNSLHLTTFSLQYTPPVVACVCI-HLACKWSNWEIPVSTDGKHWWEYVDATVTLEL 233

  Fly   232 L------FVSAREKLPGLIDAVRKIRI--MVKQYQQPDR 262
            |      |:...||.|..:..:...|.  ..|:.:..||
Human   234 LDELTHEFLQILEKTPNRLKRIWNWRACEAAKKTKADDR 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycHNP_524207.1 ccl1 2..307 CDD:129660 60/299 (20%)
CYCLIN 63..>127 CDD:238003 13/73 (18%)
Cyclin_C_2 159..257 CDD:293504 23/121 (19%)
CCNT1NP_001231.2 Cyclin_N 13..149 CDD:278560 31/161 (19%)
Nuclear localization signal, and interaction with Tat-TAR RNA. /evidence=ECO:0000255 253..270 2/16 (13%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 360..385
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 487..650
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 688..726
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149867
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5333
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.