DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycH and CCNK

DIOPT Version :9

Sequence 1:NP_524207.1 Gene:CycH / 40429 FlyBaseID:FBgn0022936 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_001092872.1 Gene:CCNK / 8812 HGNCID:1596 Length:580 Species:Homo sapiens


Alignment Length:189 Identity:46/189 - (24%)
Similarity:81/189 - (42%) Gaps:30/189 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 LTSAEERLLLKQYEIYLFDFCRRFEPTMPKCVVGTAFHYFKRFYLNNSPMDYHPKEIL-ATCVFV 111
            |..|.|....::...::||...|.  .:....:.|...||.|||:.:|...: |:.:. |.|:|:
Human    41 LDPATEARYRREGARFIFDVGTRL--GLHYDTLATGIIYFHRFYMFHSFKQF-PRYVTGACCLFL 102

  Fly   112 ACKVEEF----------------NVSINQFVNNIKGDRNKATDIVLSNELLLIGQLNYYLTIHNP 160
            |.||||.                :|...||     ||..|...:||  |.:|:..:.:.|.:.:|
Human   103 AGKVEETPKKCKDIIKTARSLLNDVQFGQF-----GDDPKEEVMVL--ERILLQTIKFDLQVEHP 160

  Fly   161 FRPIEGFLIDIKTRSNMQNPDRLRPHIDSFIDSTYYSDACLLHTPSQIALAAVLHAASR 219
            ::.:..:...:|...|  ...:|.....:|::.:..:...|...|..||: ||::.|.|
Human   161 YQFLLKYAKQLKGDKN--KIQKLVQMAWTFVNDSLCTTLSLQWEPEIIAV-AVMYLAGR 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycHNP_524207.1 ccl1 2..307 CDD:129660 46/189 (24%)
CYCLIN 63..>127 CDD:238003 22/80 (28%)
Cyclin_C_2 159..257 CDD:293504 13/61 (21%)
CCNKNP_001092872.1 CYCLIN_CCNK_rpt1 40..154 CDD:410233 32/122 (26%)
CYCLIN_CCNK_rpt2 158..258 CDD:410234 13/62 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 262..580
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5333
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.