DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycH and SSN8

DIOPT Version :9

Sequence 1:NP_524207.1 Gene:CycH / 40429 FlyBaseID:FBgn0022936 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_014373.3 Gene:SSN8 / 855706 SGDID:S000004970 Length:323 Species:Saccharomyces cerevisiae


Alignment Length:347 Identity:79/347 - (22%)
Similarity:139/347 - (40%) Gaps:94/347 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SSQKRSWTF-----ANEGQ---LMEFR----------------VEQN-SKYIE-SHEEEAQGRDL 43
            |:|:..|.:     |.|.|   |:|.:                :||: :|.|. :|.:....:|.
Yeast     8 STQRHHWQYTKASLAKERQKLWLLECQLFPQGLNIVMDSKQNGIEQSITKNIPITHRDLHYDKDY 72

  Fly    44 NE----HFL-TSAEERLLLKQYEIYLFDFCRRFEPTMPKCVVGTAFHYFKRFYLNNSPMDYHPKE 103
            |.    :|| .....||.::||                  .:.||..|..||.:..|..:.:...
Yeast    73 NLRIYCYFLIMKLGRRLNIRQY------------------ALATAHIYLSRFLIKASVREINLYM 119

  Fly   104 ILATCVFVACKVEEFNVSINQFVNN--------IKGDRNKATDIVLSNELLLIGQLNYYLTIHNP 160
            ::.|||::||||||....|...|:.        |..|..|.|:.    |..|:.:|..||.:|:|
Yeast   120 LVTTCVYLACKVEECPQYIRTLVSEARTLWPEFIPPDPTKVTEF----EFYLLEELESYLIVHHP 180

  Fly   161 FRPIEGFLIDIKTRSNMQNPDRLRPHID------SFIDSTYYSDACLLHTPSQIALAAV-----L 214
            ::.::..:..:|     |.|.::....|      |.|:.:|.:|..||:.|..||:|.:     :
Yeast   181 YQSLKQIVQVLK-----QPPFQITLSSDDLQNCWSLINDSYINDVHLLYPPHIIAVACLFITISI 240

  Fly   215 HAASREQENLDSYVTDLLFVSAREKLPGLIDAVRKIRIMVKQYQQPDREKVKAIEKKLDKCRNQA 279
            |....:..:|.|        :|.|.:....::...::|...::.   .|.:..:|:.:|..:.|.
Yeast   241 HGKPTKGSSLAS--------AASEAIRDPKNSSSPVQIAFNRFM---AESLVDLEEVMDTIQEQI 294

  Fly   280 NNPDS-ELYKER-----LRRLY 295
            ...|. :.|.|:     |..||
Yeast   295 TLYDHWDKYHEQWIKFLLHTLY 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycHNP_524207.1 ccl1 2..307 CDD:129660 79/347 (23%)
CYCLIN 63..>127 CDD:238003 16/63 (25%)
Cyclin_C_2 159..257 CDD:293504 21/108 (19%)
SSN8NP_014373.3 CCL1 27..323 CDD:227640 73/328 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5333
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.