DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycH and CTK2

DIOPT Version :9

Sequence 1:NP_524207.1 Gene:CycH / 40429 FlyBaseID:FBgn0022936 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_012528.1 Gene:CTK2 / 853450 SGDID:S000003543 Length:323 Species:Saccharomyces cerevisiae


Alignment Length:173 Identity:37/173 - (21%)
Similarity:75/173 - (43%) Gaps:29/173 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 TFANEGQLMEFRVEQNSKYIESHEEEAQGRDLNEHFLTSAEERLLLKQYEIYLFDFCRRFEPTMP 76
            ||  |.||...|...:.:.|    :.||...::::...:.::..:.|    :|.|.|.:.:  .|
Yeast     4 TF--ESQLFFSRPFLSKRQI----QRAQKNTISDYRNYNQKKLAVFK----FLSDLCVQLK--FP 56

  Fly    77 KCVVGTAFHYFKRFYLNN---SPMDYHPKEILATCVFVACKVEEFNVSINQFVNNIKGDRNKA-- 136
            :..:.||.::::|::|.|   :.:.|   .:..:|:.:.||..|.....|.........||..  
Yeast    57 RKTLETAVYFYQRYHLFNRFETEVCY---TVATSCLTLGCKEVETIKKTNDICTLSLRLRNVVKI 118

  Fly   137 -TDI-------VLSNELLLIGQLNYYLTIHNPFRPIEGFLIDI 171
             |||       |...||.::...::...::| :..|:.::|.|
Yeast   119 NTDILENFKKRVFQIELRILESCSFDYRVNN-YVHIDEYVIKI 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycHNP_524207.1 ccl1 2..307 CDD:129660 37/173 (21%)
CYCLIN 63..>127 CDD:238003 15/66 (23%)
Cyclin_C_2 159..257 CDD:293504 4/13 (31%)
CTK2NP_012528.1 CCL1 1..299 CDD:227640 37/173 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5333
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.