DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycH and Ccnq

DIOPT Version :10

Sequence 1:NP_524207.1 Gene:CycH / 40429 FlyBaseID:FBgn0022936 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_932106.1 Gene:Ccnq / 69109 MGIID:1916359 Length:250 Species:Mus musculus


Alignment Length:196 Identity:36/196 - (18%)
Similarity:76/196 - (38%) Gaps:38/196 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 MPKCVVGTAFHYFKRFYLNNSPMDYHPKEILATCVFVACKVEEFNVSINQFVNNIKGDRNKAT-- 137
            |....:.||...:.:|:...:...|....:..:.:::|.||||.::.....:|......|..:  
Mouse    45 MQSIPIATACTIYHKFFCEINLDAYDLYLVAMSSIYLAGKVEEQHLRTRDIINVSHRYFNPGSEP 109

  Fly   138 -----------DIVLSNELLLIGQLNYYLTIHNPFRPIEGFLIDIKTRSNMQNPDRLRPHIDSF- 190
                       |.::..|||::..|.:.::..:|.:.:..:||.:|...|..:..|....:.:: 
Mouse   110 LELDSRFWELRDSIVQCELLMLRVLRFQVSFQHPHKYLLHYLISLKNWLNRYSWQRTPISVTAWA 174

  Fly   191 -IDSTYYSDACLLHTPSQIALAAVLHA---------ASREQEN--------------LDSYVTDL 231
             :..:|:...||......:|:|.:..|         |..|.|.              :|:.|:||
Mouse   175 LLRDSYHGGLCLRFQAQHLAVAVLYLALQVYGVEVPAEGEAEKPWWQVFSDDLTKPIIDNIVSDL 239

  Fly   232 L 232
            :
Mouse   240 I 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycHNP_524207.1 ccl1 2..307 CDD:129660 36/196 (18%)
CcnqNP_932106.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..23
CYCLIN_CCNM_CCNQ_rpt1 28..137 CDD:410237 17/91 (19%)
CYCLIN_CCNM_CCNQ_rpt2 142..245 CDD:410238 19/99 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.