DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycH and ccnl2

DIOPT Version :9

Sequence 1:NP_524207.1 Gene:CycH / 40429 FlyBaseID:FBgn0022936 Length:324 Species:Drosophila melanogaster
Sequence 2:XP_012822126.1 Gene:ccnl2 / 595011 XenbaseID:XB-GENE-956522 Length:501 Species:Xenopus tropicalis


Alignment Length:245 Identity:42/245 - (17%)
Similarity:96/245 - (39%) Gaps:52/245 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 MPKCVVGTAFHYFKRFYLNNSPMDYHPKEILATCVFVACKVEEFNVSINQFVNNIK-----GDRN 134
            :|:..:.|....|:||:...|.:.:..:.:...||.:|.|:||....|...:|...     .::.
 Frog    77 LPQVAMATGQVLFQRFFYTKSFVKHSMEHVAMACVHLASKIEEAPRRIRDVINVFHRLRQLREKQ 141

  Fly   135 KATDIVLSNELL------------LIGQLNYYLTIHNPFRPIEGFLIDIKTRSNMQNPDRLRPHI 187
            |:|.::|..|.:            ::.:|.:.:.:.:|.:.|..:|..::...|        .|:
 Frog   142 KSTPLILDQEYVNLKNQIIKAERRVLKELGFCVHVKHPHKIIVMYLQVLECERN--------KHL 198

  Fly   188 D----SFIDSTYYSDACLLHTPSQIALAAVLHAASREQENLDSYVTDLLFVSAREKLPGLIDAVR 248
            .    ::::.:..:|..:...|..||.|.:..||...:..|.:.........|.|      :.::
 Frog   199 VQTSWNYMNDSLRTDVFVRFNPETIACACIFLAARTLEIPLPNRPHWFYLFGASE------EDIK 257

  Fly   249 KIRIMVKQYQQPDREKVKAIEKKLDKCRNQANNPDSELYKERLRRLYTDE 298
            :|.:.:.:.....:..|..:|.|::|                 |:|:.:|
 Frog   258 EICLQILRLYTRKKADVALLENKVEK-----------------RKLFIEE 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycHNP_524207.1 ccl1 2..307 CDD:129660 42/245 (17%)
CYCLIN 63..>127 CDD:238003 13/51 (25%)
Cyclin_C_2 159..257 CDD:293504 16/101 (16%)
ccnl2XP_012822126.1 CYCLIN 60..133 CDD:238003 14/55 (25%)
CYCLIN 183..265 CDD:214641 15/95 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.