DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycH and CCNL1

DIOPT Version :9

Sequence 1:NP_524207.1 Gene:CycH / 40429 FlyBaseID:FBgn0022936 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_064703.1 Gene:CCNL1 / 57018 HGNCID:20569 Length:526 Species:Homo sapiens


Alignment Length:243 Identity:56/243 - (23%)
Similarity:104/243 - (42%) Gaps:52/243 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 MPKCVVGTAFHYFKRFYLNNSPMDYHPKEILA-TCVFVACKVEEFNVSINQFVN------NIKGD 132
            :|:..:.|....|.||:.:.|.:. |..||:| .|:.:|.|:||....|...:|      .::|.
Human    99 LPQVAMATGQVLFHRFFYSKSFVK-HSFEIVAMACINLASKIEEAPRRIRDVINVFHHLRQLRGK 162

  Fly   133 RNKATDI-----------VLSNELLLIGQLNYYLTIHNPFRPIEGFL---------IDIKTRSNM 177
            |..:..|           |:..|..::.:|.:.:.:.:|.:.|..:|         ..::|..|.
Human   163 RTPSPLILDQNYINTKNQVIKAERRVLKELGFCVHVKHPHKIIVMYLQVLECERNQTLVQTAWNY 227

  Fly   178 QNPDRLRPHIDSFIDSTYYSDACLLHTPSQIALAAVLHAASREQENLDSYV-TDLLFVSAREKLP 241
            .| |.||.::  |:          ...|..||.|.:..||...|..|.:.. ..|||.:..|::.
Human   228 MN-DSLRTNV--FV----------RFQPETIACACIYLAARALQIPLPTRPHWFLLFGTTEEEIQ 279

  Fly   242 GLIDAVRKIRIMVKQYQQPDREKV-KAIEKK---LDKCRNQAN--NPD 283
            .:  .:..:|:..:  ::|:.|.: |.:||:   |.:.:.:|.  |||
Human   280 EI--CIETLRLYTR--KKPNYELLEKEVEKRKVALQEAKLKAKGLNPD 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycHNP_524207.1 ccl1 2..307 CDD:129660 56/243 (23%)
CYCLIN 63..>127 CDD:238003 16/52 (31%)
Cyclin_C_2 159..257 CDD:293504 23/107 (21%)
CCNL1NP_064703.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..36
CYCLIN_SF 40..195 CDD:424085 23/96 (24%)
Cyclin-like 1 88..190 22/91 (24%)
CYCLIN_SF 199..321 CDD:424085 30/138 (22%)
Cyclin-like 2 203..287 21/98 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 318..526 3/6 (50%)
RS 390..432
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149872
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5333
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.