DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycH and ccnk

DIOPT Version :9

Sequence 1:NP_524207.1 Gene:CycH / 40429 FlyBaseID:FBgn0022936 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_001157251.1 Gene:ccnk / 569432 ZFINID:ZDB-GENE-030131-5126 Length:539 Species:Danio rerio


Alignment Length:328 Identity:72/328 - (21%)
Similarity:126/328 - (38%) Gaps:71/328 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 LTSAEERLLLKQYEIYLFDFCRRFEPTMPKCVVGTAFHYFKRFYLNNSPMDYHPKEIL-ATCVFV 111
            |..|.|....::...::||...|.  .:....:.|...||.|||:.:|...: |:.:. |.|:|:
Zfish    42 LDPATEARYRREGARFIFDVGTRL--GLHYDTLATGITYFHRFYMFHSFKQF-PRYVTGACCLFL 103

  Fly   112 ACKVEEF----------------NVSINQFVNNIKGDRNKATDIVLSNELLLIGQLNYYLTIHNP 160
            |.||||.                :|...||     ||..|...:||  |.:|:..:.:.|.:.:|
Zfish   104 AGKVEETPKKCKDIIKTARSLLNDVQFAQF-----GDDPKEEVMVL--ERILLQTIKFDLQVEHP 161

  Fly   161 FRPIEGFLIDIKTRSNMQNPDRLRPHIDSFIDSTYYSDACLLHTPSQIALAAVLHAASR------ 219
            ::.:..:...:|...|  ...:|.....:|::.:..:...|...|..||: ||::.|.|      
Zfish   162 YQFLLRYAKQLKGDKN--KVQKLVQMAWTFVNDSLCTMLSLQWEPEIIAV-AVMYLAGRLCKFDI 223

  Fly   220 -----EQEN---LDSYVTDLLFVSAREKLPGLIDAVRKIRIMVKQYQQP--------DREK---V 265
                 :|.:   .:.:|.|:       .:..|.|...:|..:..|.:||        |:||   .
Zfish   224 QEWTSKQSSRRWWEQFVQDV-------PVELLEDICHQILDLYSQGKQPIPQQPPMQDKEKPPPP 281

  Fly   266 KAIEKKLDKCRNQANNPDSELYK------ERLRRLYT---DEDDMPAEDASFHIADVSSDTSAMN 321
            .|........:|....|.|:...      .:::|.:.   ||...|||.....|..:.|....:.
Zfish   282 PAAPPGQSGAQNPPAQPPSKKNSPQASPPAKIKRQHVSPKDEPKAPAEQVGSKIPRLESPMPPLP 346

  Fly   322 ISQ 324
            :||
Zfish   347 VSQ 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycHNP_524207.1 ccl1 2..307 CDD:129660 68/309 (22%)
CYCLIN 63..>127 CDD:238003 22/80 (28%)
Cyclin_C_2 159..257 CDD:293504 19/111 (17%)
ccnkNP_001157251.1 CYCLIN 51..149 CDD:238003 28/107 (26%)
CYCLIN 160..259 CDD:238003 19/108 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5333
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.