DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycH and Ccnl2

DIOPT Version :9

Sequence 1:NP_524207.1 Gene:CycH / 40429 FlyBaseID:FBgn0022936 Length:324 Species:Drosophila melanogaster
Sequence 2:XP_036020147.1 Gene:Ccnl2 / 56036 MGIID:1927119 Length:519 Species:Mus musculus


Alignment Length:228 Identity:45/228 - (19%)
Similarity:95/228 - (41%) Gaps:49/228 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 MPKCVVGTAFHYFKRFYLNNSPMDYHPKEILATCVFVACKVEEFNVSINQFVN------NIKGDR 133
            :|:..:.|....|:||:...|.:.:..:.:...||.:|.|:||....|...:|      ::: ::
Mouse    92 LPQVAMATGQVLFQRFFYTKSFVKHSMEHVSMACVHLASKIEEAPRRIRDVINVFHRLRHLR-EK 155

  Fly   134 NKATDIVLSNELL------------LIGQLNYYLTIHNPFRPIEGFLIDIKTRSNMQNPDRLRPH 186
            .|...:||..|.:            ::.:|.:.:.:.:|.:.|..:|..::...|.        |
Mouse   156 KKPVPLVLDQEYVNLKNQIIKAERRVLKELGFCVHVKHPHKIIVMYLQVLECERNQ--------H 212

  Fly   187 ID----SFIDSTYYSDACLLHTPSQIALAAVLHAASREQE----NLDSYVTDLLFVSAREKLPGL 243
            :.    ::::.:..:|..:...|..||.|.: :.|:|..|    |...:.  |||.:..|::.  
Mouse   213 LVQTAWNYMNDSLRTDVFVRFQPESIACACI-YLAARTLEIPLPNRPHWF--LLFGATEEEIQ-- 272

  Fly   244 IDAVRKIRIMVKQYQQPDREKVKA--IEKKLDK 274
                   .|..|..|...|:||..  :|.:::|
Mouse   273 -------EICFKILQLYTRKKVDLTHLESEVEK 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycHNP_524207.1 ccl1 2..307 CDD:129660 45/228 (20%)
CYCLIN 63..>127 CDD:238003 13/51 (25%)
Cyclin_C_2 159..257 CDD:293504 20/105 (19%)
Ccnl2XP_036020147.1 CYCLIN_CCNL2_rpt1 33..188 CDD:410293 19/96 (20%)
CYCLIN_CCNL2_rpt2 193..315 CDD:410296 26/126 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167839919
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5333
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.