Sequence 1: | NP_524207.1 | Gene: | CycH / 40429 | FlyBaseID: | FBgn0022936 | Length: | 324 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_009295009.1 | Gene: | ccnq / 553650 | ZFINID: | ZDB-GENE-050522-495 | Length: | 254 | Species: | Danio rerio |
Alignment Length: | 205 | Identity: | 47/205 - (22%) |
---|---|---|---|
Similarity: | 86/205 - (41%) | Gaps: | 40/205 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 37 EAQGRDLNEHFLTSAEERLLLKQYEIYLFDFCRRFEPT------------MPKCVVGTAFHYFKR 89
Fly 90 FYLNNSPMDYHPKEILATCVFVACKVEEFNVSINQFVN-------------NIKGDRNKATDIVL 141
Fly 142 SNELLLIGQLNYYLTIHNPFRPIEGFLIDIKTRSNMQNPDRLRPHID---SFIDSTYYSDACLLH 203
Fly 204 TPSQIALAAV 213 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CycH | NP_524207.1 | ccl1 | 2..307 | CDD:129660 | 47/205 (23%) |
CYCLIN | 63..>127 | CDD:238003 | 17/75 (23%) | ||
Cyclin_C_2 | 159..257 | CDD:293504 | 12/58 (21%) | ||
ccnq | XP_009295009.1 | CYCLIN | 49..138 | CDD:238003 | 19/88 (22%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5333 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |