DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycH and ccnq

DIOPT Version :9

Sequence 1:NP_524207.1 Gene:CycH / 40429 FlyBaseID:FBgn0022936 Length:324 Species:Drosophila melanogaster
Sequence 2:XP_009295009.1 Gene:ccnq / 553650 ZFINID:ZDB-GENE-050522-495 Length:254 Species:Danio rerio


Alignment Length:205 Identity:47/205 - (22%)
Similarity:86/205 - (41%) Gaps:40/205 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 EAQGRDLNEHFLTSAEERLLLKQYEIYLFDFCRRFEPT------------MPKCVVGTAFHYFKR 89
            ||:||       .|||:    .:|....|..||....|            |....:.||...:.|
Zfish    13 EARGR-------RSAED----VEYSKTHFRVCRFITETGICIFMKWVKLGMRSVPMATACVLYHR 66

  Fly    90 FYLNNSPMDYHPKEILATCVFVACKVEEFNVSINQFVN-------------NIKGDRNKATDIVL 141
            |:.:.|...|.|..:..:.:::|.||||.::.....:|             .:.|...:..|.::
Zfish    67 FFQSASLQIYEPYLVAMSAIYLAGKVEEQHLRTRDIINVCHRYFHPDSEPLELNGKFWELRDSIV 131

  Fly   142 SNELLLIGQLNYYLTIHNPFRPIEGFLIDIKTRSNMQNPDRLRPHID---SFIDSTYYSDACLLH 203
            ..|||::.|||:.:|..:|.:.:..:|:.:::..|.....| .|..:   :.:..:|:...|:.|
Zfish   132 QCELLILRQLNFQVTFEHPHKYLLHYLLSVRSLLNRHAWSR-TPIAETALAVLKDSYHGSVCVRH 195

  Fly   204 TPSQIALAAV 213
            .|..:||.|:
Zfish   196 RPQHLALTAL 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycHNP_524207.1 ccl1 2..307 CDD:129660 47/205 (23%)
CYCLIN 63..>127 CDD:238003 17/75 (23%)
Cyclin_C_2 159..257 CDD:293504 12/58 (21%)
ccnqXP_009295009.1 CYCLIN 49..138 CDD:238003 19/88 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5333
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.