DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycH and ccnl1a

DIOPT Version :9

Sequence 1:NP_524207.1 Gene:CycH / 40429 FlyBaseID:FBgn0022936 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_001082832.1 Gene:ccnl1a / 553269 ZFINID:ZDB-GENE-050419-206 Length:534 Species:Danio rerio


Alignment Length:276 Identity:64/276 - (23%)
Similarity:115/276 - (41%) Gaps:57/276 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 MPKCVVGTAFHYFKRFYLNNSPMDYHPKEILA-TCVFVACKVEEFNVSINQFVN------NIKGD 132
            :|:..:.|....|.||:.:.|.:. |..||:| .||.:|.|:||....|...:|      .::|.
Zfish    82 LPQVAMATGQVLFHRFFYSKSFVK-HSFEIVAMACVNLASKIEEAPRRIRDVINVFHHLRQLRGK 145

  Fly   133 RNKATDI-----------VLSNELLLIGQLNYYLTIHNPFRPIEGFL---------IDIKTRSNM 177
            |:.:..|           |:..|..::.:|.:.:.:.:|.:.|..:|         ..::|..|.
Zfish   146 RSPSPLILDQNYINTKNQVIKAERRILKELGFCVHVKHPHKIIVMYLQVLECEKNQTLVQTAWNY 210

  Fly   178 QNPDRLRPHIDSFIDSTYYSDACLLHTPSQIALAAVLHAASREQENLDSY-VTDLLFVSAREKLP 241
            .| |.||.::  |:.....:.||          |.:..||...|.:|.|. :..|||.:..|::.
Zfish   211 MN-DSLRTNV--FVRFQAETIAC----------ACIYLAARVLQISLPSRPIWYLLFGATEEEIK 262

  Fly   242 GLIDAVRKIRIMVKQYQQPDREKVKAIEKKLDKCRNQANNPDSELYKERLRRLYTDEDDMPAEDA 306
            .:.....|:...    ::|:.:   .:||::|| |..|      :...:|:....:.|..|| ..
Zfish   263 DICTTTLKLYTR----RKPNYD---LLEKEVDK-RKMA------IQDAKLKAKGLNPDGTPA-IC 312

  Fly   307 SFHIADVSSDTSAMNI 322
            ||.....:|..|:.||
Zfish   313 SFGGFSPASKPSSPNI 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycHNP_524207.1 ccl1 2..307 CDD:129660 58/259 (22%)
CYCLIN 63..>127 CDD:238003 17/52 (33%)
Cyclin_C_2 159..257 CDD:293504 23/107 (21%)
ccnl1aNP_001082832.1 CYCLIN 65..137 CDD:238003 18/55 (33%)
CYCLIN 188..264 CDD:214641 21/88 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170584014
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5333
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.