DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycH and CycC

DIOPT Version :9

Sequence 1:NP_524207.1 Gene:CycH / 40429 FlyBaseID:FBgn0022936 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_476848.1 Gene:CycC / 41801 FlyBaseID:FBgn0004597 Length:267 Species:Drosophila melanogaster


Alignment Length:294 Identity:72/294 - (24%)
Similarity:121/294 - (41%) Gaps:65/294 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SSQKRSWTFANEGQLMEFRVEQNSKYIESHEEEAQGRDLNEHFLTSAE------ERLLLKQYEIY 63
            ||..:.|.......|.    |:....:..:|:|.|     :.|:..|.      |:|.|:|.   
  Fly     8 SSHSQQWILDKPDLLR----ERQHDLLALNEDEYQ-----KVFIFFANVIQVLGEQLKLRQQ--- 60

  Fly    64 LFDFCRRFEPTMPKCVVGTAFHYFKRFYLNNSPMDYHPKEILATCVFVACKVEEFNVSINQFVNN 128
                           |:.||..||||||..||..:..|..:..||:.:|.|||||.|..|..:.:
  Fly    61 ---------------VIATATVYFKRFYARNSLKNIDPLLLAPTCILLASKVEEFGVISNSRLIS 110

  Fly   129 IKGDRNKA-------------TDIVLSNELLLIGQLNYYLTIHNPFRPIEGFLIDIKTRSNMQNP 180
            |.....|.             |:.:|..|..|:..|:..|.::.|:||:      ::...:|...
  Fly   111 ICQSAIKTKFSYAYAQEFPYRTNHILECEFYLLENLDCCLIVYQPYRPL------LQLVQDMGQE 169

  Fly   181 DRLRPHIDSFIDSTYYSDACLLHTPSQIALAAVLHAASREQENLDSYVTDLLFVSAREKLPGLID 245
            |:|.......::.:..:|.|||:.|.|||:|.:..|....|::    .|...|......|    |
  Fly   170 DQLLTLSWRIVNDSLRTDVCLLYPPYQIAIACLQIACVILQKD----ATKQWFAELNVDL----D 226

  Fly   246 AVRKI-RIMVKQYQ----QPDREKVKAIEKKLDK 274
            .|::| |.:|..|:    ..::::::.:..|:.|
  Fly   227 KVQEIVRAIVNLYELWKDWKEKDEIQMLLSKIPK 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycHNP_524207.1 ccl1 2..307 CDD:129660 72/294 (24%)
CYCLIN 63..>127 CDD:238003 22/63 (35%)
Cyclin_C_2 159..257 CDD:293504 25/98 (26%)
CycCNP_476848.1 CYCLIN_CCNC_rpt1 40..146 CDD:410217 34/123 (28%)
CYCLIN_CCNC_rpt2 154..245 CDD:410218 26/104 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453864
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5333
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10026
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.