DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycH and ccnc

DIOPT Version :9

Sequence 1:NP_524207.1 Gene:CycH / 40429 FlyBaseID:FBgn0022936 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_956245.1 Gene:ccnc / 335429 ZFINID:ZDB-GENE-030131-7369 Length:283 Species:Danio rerio


Alignment Length:329 Identity:84/329 - (25%)
Similarity:132/329 - (40%) Gaps:101/329 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 QNSKYIE---SHEEEAQGRDLNEHFLTSAE----------------ERLLLKQYEIYLFDFCRRF 71
            |:|.|::   ..::..:.|..:..|||..|                |.|.|:|.           
Zfish     7 QSSHYLQWVLDKQDLMKERQKDLKFLTEEEYWKLQIFFANVIQALGEHLKLRQQ----------- 60

  Fly    72 EPTMPKCVVGTAFHYFKRFYLNNSPMDYHPKEILATCVFVACKVEEFNVSINQFVNNIKGDRNKA 136
                   |:.||..||||||...|.....|..:..||||:|.|||||.|..|..:      .:.|
Zfish    61 -------VIATATVYFKRFYARYSLKSIDPVLMAPTCVFLASKVEEFGVVSNTRL------ISAA 112

  Fly   137 TDI-------------------VLSNELLLIGQLNYYLTIHNPFRPIEGFLIDIKTRSNMQNPDR 182
            |.:                   :|..|..|:..::..|.:::|:||:..::.|      |...|.
Zfish   113 TSVLKTRFSYAFPKEFPFRMNHILECEFYLLELMDCCLIVYHPYRPLLQYVQD------MGQEDM 171

  Fly   183 LRPHIDSFIDSTYYSDACLLHTPSQIALAAVLHAASREQENLDSYVTDLLFVSAREKLPGLIDAV 247
            |.|.....::.||.:|.|||:.|..||||. ||.|...|:.           .||:....|...:
Zfish   172 LLPLAWRIVNDTYRTDLCLLYPPFMIALAC-LHVACVVQQK-----------DARQWFAELSVDM 224

  Fly   248 RK----IRIMVKQYQQ----PDREKVKAIEKKLDKCRNQANNPDSELYKERLRRLYTDEDDMPAE 304
            .|    ||:::|.|.|    .||:::.|:..|:.|.:..   |:||          ||:....::
Zfish   225 EKILEIIRVILKLYDQWKNFDDRKEIAAVLNKVPKPKPP---PNSE----------TDQSSNGSQ 276

  Fly   305 DASF 308
            ::|:
Zfish   277 NSSY 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycHNP_524207.1 ccl1 2..307 CDD:129660 83/326 (25%)
CYCLIN 63..>127 CDD:238003 23/63 (37%)
Cyclin_C_2 159..257 CDD:293504 30/101 (30%)
ccncNP_956245.1 CYCLIN 48..>99 CDD:238003 22/68 (32%)
Cyclin_C_2 154..241 CDD:293504 31/104 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5333
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.