DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycH and ccnt1

DIOPT Version :9

Sequence 1:NP_524207.1 Gene:CycH / 40429 FlyBaseID:FBgn0022936 Length:324 Species:Drosophila melanogaster
Sequence 2:XP_005162427.1 Gene:ccnt1 / 334465 ZFINID:ZDB-GENE-030131-6397 Length:713 Species:Danio rerio


Alignment Length:341 Identity:65/341 - (19%)
Similarity:118/341 - (34%) Gaps:98/341 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 YPVSSQKRS-WTFANEGQLMEFRVEQNSKYIESHEEEAQGRDLNEHFLTSAEERLLLKQYEIYLF 65
            :|..||..: |.|..|             .||:......|.|.::......:...||:       
Zfish     5 FPSPSQNNNKWYFTRE-------------QIENSPSRRAGLDPDKELSYRQQAANLLQ------- 49

  Fly    66 DFCRRFEPTMPKCVVGTAFHYFKRFYLNNSPMDYHPKEILATCVFVACKVEEFNVSINQFVN--- 127
            |..:|.  .:.:..:.||..|..|||:..|...:|...|....:|:|.||||....:...:.   
Zfish    50 DMGQRL--NVSQLTINTAIVYMHRFYMVQSFTRFHRNVIAPAALFLAAKVEEQPRKLEHVIKVTH 112

  Fly   128 ----------NIKGDR--NKATDIVLSNELLLIGQLNYYLTIHNPFRPI---------EGFLIDI 171
                      :.:.|.  .:|.|:|:. |.:::..|.:.:||.:|...:         |..|:.:
Zfish   113 ACLNPQDPSPDTRSDTYLQQAQDLVIL-ESIILQTLGFEITIDHPHTHVVKCTQLVRGENQLLTL 176

  Fly   172 ------KTRSNMQNP-DRLRPHIDSF------------------IDSTYYSDACLLHTPSQIALA 211
                  ..:.....| .::...|.||                  .:|.:.:..||.::|..:|..
Zfish   177 NCASYCSVKGTSSTPSSQISRLIMSFPFIVPASKDLAQTSYFMATNSLHLTTFCLQYSPPIVACV 241

  Fly   212 AVLHAASREQ--------------ENLDSYVT-DLL------FVSAREKLPGLIDAVRKIRI--- 252
            .: |.|.:..              :.:|..|| :||      |:...||.|..:...|..:.   
Zfish   242 CI-HLACKWSNWEIPVSTDGKHWWQYVDPTVTLELLDELTHEFLQILEKTPSRLKRTRNWKAAGQ 305

  Fly   253 MVKQYQQPDREKVKAI 268
            ..|:.:..|.::.:||
Zfish   306 TAKKSKVQDGDQSEAI 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycHNP_524207.1 ccl1 2..307 CDD:129660 65/341 (19%)
CYCLIN 63..>127 CDD:238003 17/63 (27%)
Cyclin_C_2 159..257 CDD:293504 25/155 (16%)
ccnt1XP_005162427.1 Cyclin_N 16..152 CDD:278560 31/158 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170584009
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5333
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.