DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycH and ccnl1b

DIOPT Version :9

Sequence 1:NP_524207.1 Gene:CycH / 40429 FlyBaseID:FBgn0022936 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_956034.1 Gene:ccnl1b / 326088 ZFINID:ZDB-GENE-030131-4813 Length:498 Species:Danio rerio


Alignment Length:325 Identity:66/325 - (20%)
Similarity:123/325 - (37%) Gaps:88/325 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 CRRFEPT-----MPKCVVGTAFHYFKRFYLNNSPMDYHPKEILATCVFVACKVEEFNVSINQFVN 127
            |.|.:..     :|:..:.|....|:||:.:.|.:.::.:.:...||.:|.|:||....:...:|
Zfish    67 CERIQSAGILLRLPQVAMATGQVIFQRFFFSKSFVKHNFEIVAMACVNLASKIEESPRRVRDVIN 131

  Fly   128 ---NIK-GDRNKATDIVL-------SNELL-----LIGQLNYYLTIHNPFRPIEGFL-------- 168
               ::| |...|:|.::|       .|:::     ::.:|.:.:.:.:|.:.|..:|        
Zfish   132 VFHHLKQGKGKKSTPLILDQNYINTKNQVIKAERRILKELGFCVHVKHPHKIIVMYLQVLECEKN 196

  Fly   169 -IDIKTRSNMQNPDRLRPHIDSFIDSTYYSDACLLHTPSQIALAAVLHAASREQENLDSYV-TDL 231
             :.::|..|..| |.||            :.|.:...|..||.|.:..||...|..|.|.. ..|
Zfish   197 QMLVQTAWNYMN-DALR------------TSAFVRFEPETIACACIYLAARVLQIPLPSKPHWFL 248

  Fly   232 LFVSAREKLPGLIDAVRKIRIMVKQY-----QQPDREKVKAIEKKLDKCRNQANN---------- 281
            ||.:.:|.:..:.....|:....|.:     :|.::.|:...|.:| |.|.|..|          
Zfish   249 LFGATKEDIKEICINTMKLYSREKPHSEQLERQVEKRKIFLEEARL-KARGQNPNGTPALASING 312

  Fly   282 -------------------PDSELYKERLRRLYT---------DEDDMPAEDASFHIADVSSDTS 318
                               |:|:|.:...|:|:.         .||....::...|....|..||
Zfish   313 FSPASKPSSPRDVKMDDKSPNSKLKEPENRQLFAKSPLNGSIKKEDGKVFQNGKNHSRSRSRSTS 377

  Fly   319  318
            Zfish   378  377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycHNP_524207.1 ccl1 2..307 CDD:129660 62/312 (20%)
CYCLIN 63..>127 CDD:238003 14/63 (22%)
Cyclin_C_2 159..257 CDD:293504 25/107 (23%)
ccnl1bNP_956034.1 CYCLIN 62..134 CDD:238003 15/66 (23%)
Cyclin-like 1 68..169 20/100 (20%)
Cyclin-like 2 182..266 22/96 (23%)
CYCLIN 184..260 CDD:214641 22/88 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 294..498 16/85 (19%)
RS 366..396 4/12 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5333
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.