DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycH and CG16903

DIOPT Version :9

Sequence 1:NP_524207.1 Gene:CycH / 40429 FlyBaseID:FBgn0022936 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_569980.1 Gene:CG16903 / 31178 FlyBaseID:FBgn0040394 Length:560 Species:Drosophila melanogaster


Alignment Length:333 Identity:66/333 - (19%)
Similarity:134/333 - (40%) Gaps:86/333 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MYPVSSQKRSWTFAN----EGQLMEFRVEQNSKYIESHEEEAQGRDLNEHFLTSAEERLLLKQYE 61
            :||....:...|..|    ||::   .|..:|:....||.|...|.|....:.:|  .:||:   
  Fly    74 IYPRLFNRIVLTLENSLIPEGKI---DVTPSSQDGLDHETEKDLRILGCELIQTA--GILLR--- 130

  Fly    62 IYLFDFCRRFEPTMPKCVVGTAFHYFKRFYLNNSPMDYHPKEILATCVFVACKVEEFNVSINQFV 126
                         :|:..:.|....|:||:.:.|.:.::.:.:..:||.:|.|:||....|...:
  Fly   131 -------------LPQVAMATGQVLFQRFFYSKSFVRHNMETVAMSCVCLASKIEEAPRRIRDVI 182

  Fly   127 N---NIKGDRNKA-----------TDI---VLSNELLLIGQLNYYLTIHNPFRPIEGFLIDIKTR 174
            |   :||..|.:.           |::   |:..|..::.:|.:.:.:.:|.:.|..:|..::  
  Fly   183 NVFHHIKQVRAQKEISPMVLDPYYTNLKMQVIKAERRVLKELGFCVHVKHPHKLIVMYLQVLQ-- 245

  Fly   175 SNMQNPDRLRPHIDSFIDSTYYSDACLLHTPSQIALAAVLHAASREQENLDSY------------ 227
              .:..::|.....:|::.:..:|..:.:||..||.|.:..:|.:....|.:.            
  Fly   246 --YEKHEKLMQLSWNFMNDSLRTDVFMRYTPEAIACACIYLSARKLNIPLPNSPPWFGIFRVPMA 308

  Fly   228 -VTDL------LFVSAR---EKLPGLIDAVRKIRIMVKQYQQPDREKVKAIEKKLDKCRNQANNP 282
             :||:      |::.::   |||...:|.::|..|       ..|.|.|           :||.|
  Fly   309 DITDICYRVMELYMRSKPVVEKLEAAVDELKKRYI-------DARNKTK-----------EANTP 355

  Fly   283 DSELYKER 290
            .:.:..:|
  Fly   356 PAVITVDR 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycHNP_524207.1 ccl1 2..307 CDD:129660 66/332 (20%)
CYCLIN 63..>127 CDD:238003 13/63 (21%)
Cyclin_C_2 159..257 CDD:293504 22/119 (18%)
CG16903NP_569980.1 CYCLIN 114..203 CDD:238003 22/106 (21%)
CYCLIN 235..321 CDD:214641 14/89 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453871
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5333
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10026
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.