DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycH and Ccnt2

DIOPT Version :9

Sequence 1:NP_524207.1 Gene:CycH / 40429 FlyBaseID:FBgn0022936 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_001100641.1 Gene:Ccnt2 / 304758 RGDID:1309205 Length:722 Species:Rattus norvegicus


Alignment Length:244 Identity:56/244 - (22%)
Similarity:99/244 - (40%) Gaps:48/244 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 AEERLLLKQYEIYLF-DFCRRFEPTMPKCVVGTAFHYFKRFYLNNSPMDYHPKEILATCVFVACK 114
            |:|.|..:|....|. |..:|.  .:.:..:.||..|..|||:::|...::...|..|.:|:|.|
  Rat    30 ADEELSHRQQAANLIQDMGQRL--NVSQLTINTAIVYMHRFYMHHSFTKFNRNIISPTALFLAAK 92

  Fly   115 VEEFNVSINQFVN-------------NIKGDR--NKATDIVLSNELLLIGQLNYYLTIHNPFRPI 164
            |||....:...:.             :.|.|.  .:..::||. |.:::..|.:.:||.:|...:
  Rat    93 VEEQARKLEHVIKVAHACLHPLEPLLDTKCDAYLQQTQELVLL-ETIMLQTLGFEITIEHPHTDV 156

  Fly   165 EGFLIDIK-TRSNMQNPDRLRPHIDSFIDSTYYSDACLLHTPSQIALAAVLHAASREQ------- 221
                  :| |:....:.|..:.......:|.:.:..||.:.|:.||...: |.|.:..       
  Rat   157 ------VKCTQLVRASKDLAQTSYFMATNSLHLTTFCLQYKPTVIACVCI-HLACKWSNWEIPVS 214

  Fly   222 -------ENLDSYVT-DLL------FVSAREKLPGLIDAVRKIRIMVKQ 256
                   |.:|..|| :||      |:...||.|..:..:|..|.|.|:
  Rat   215 TDGKHWWEYVDPTVTLELLDELTHEFLQILEKTPSRLKRIRNWRAMAKK 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycHNP_524207.1 ccl1 2..307 CDD:129660 56/244 (23%)
CYCLIN 63..>127 CDD:238003 18/64 (28%)
Cyclin_C_2 159..257 CDD:293504 26/120 (22%)
Ccnt2NP_001100641.1 CCL1 8..>216 CDD:227640 42/195 (22%)
CYCLIN 36..108 CDD:238003 19/73 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5333
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.