DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycH and Ccnq

DIOPT Version :9

Sequence 1:NP_524207.1 Gene:CycH / 40429 FlyBaseID:FBgn0022936 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_001020583.1 Gene:Ccnq / 303321 RGDID:1305651 Length:250 Species:Rattus norvegicus


Alignment Length:196 Identity:36/196 - (18%)
Similarity:76/196 - (38%) Gaps:38/196 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 MPKCVVGTAFHYFKRFYLNNSPMDYHPKEILATCVFVACKVEEFNVSINQFVNNIKGDRNKAT-- 137
            |....:.||...:.:|:...:...|....:..:.:::|.||||.::.....:|......|..:  
  Rat    45 MQSIPIATACTIYHKFFCEINLDAYDLYLVAMSSLYLAGKVEEQHLRTRDIINVSHRYFNPGSEP 109

  Fly   138 -----------DIVLSNELLLIGQLNYYLTIHNPFRPIEGFLIDIKTRSNMQNPDRLRPHIDSF- 190
                       |.::..|||::..|.:.::..:|.:.:..:||.:|...|..:..|....:.:: 
  Rat   110 LELDSRFWELRDSIVQCELLMLRVLRFQVSFQHPHKYLLHYLISLKNWLNRYSWQRTPISVTAWA 174

  Fly   191 -IDSTYYSDACLLHTPSQIALAAVLHA---------ASREQEN--------------LDSYVTDL 231
             :..:|:...||......:|:|.:..|         |..|.|.              :|:.|:||
  Rat   175 LLRDSYHGGLCLRFQAQHLAVAVLYLALQVYGVEVPAEGEAEKPWWQVFSDDLTKPIIDNIVSDL 239

  Fly   232 L 232
            :
  Rat   240 I 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycHNP_524207.1 ccl1 2..307 CDD:129660 36/196 (18%)
CYCLIN 63..>127 CDD:238003 10/51 (20%)
Cyclin_C_2 159..257 CDD:293504 19/99 (19%)
CcnqNP_001020583.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22
CYCLIN_CCNM_CCNQ_rpt1 29..137 CDD:410237 17/91 (19%)
CYCLIN_CCNM_CCNQ_rpt2 142..245 CDD:410238 19/99 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5333
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.