Sequence 1: | NP_524207.1 | Gene: | CycH / 40429 | FlyBaseID: | FBgn0022936 | Length: | 324 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001020583.1 | Gene: | Ccnq / 303321 | RGDID: | 1305651 | Length: | 250 | Species: | Rattus norvegicus |
Alignment Length: | 196 | Identity: | 36/196 - (18%) |
---|---|---|---|
Similarity: | 76/196 - (38%) | Gaps: | 38/196 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 75 MPKCVVGTAFHYFKRFYLNNSPMDYHPKEILATCVFVACKVEEFNVSINQFVNNIKGDRNKAT-- 137
Fly 138 -----------DIVLSNELLLIGQLNYYLTIHNPFRPIEGFLIDIKTRSNMQNPDRLRPHIDSF- 190
Fly 191 -IDSTYYSDACLLHTPSQIALAAVLHA---------ASREQEN--------------LDSYVTDL 231
Fly 232 L 232 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CycH | NP_524207.1 | ccl1 | 2..307 | CDD:129660 | 36/196 (18%) |
CYCLIN | 63..>127 | CDD:238003 | 10/51 (20%) | ||
Cyclin_C_2 | 159..257 | CDD:293504 | 19/99 (19%) | ||
Ccnq | NP_001020583.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..22 | ||
CYCLIN_CCNM_CCNQ_rpt1 | 29..137 | CDD:410237 | 17/91 (19%) | ||
CYCLIN_CCNM_CCNQ_rpt2 | 142..245 | CDD:410238 | 19/99 (19%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5333 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |