DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycH and cit-1.1

DIOPT Version :9

Sequence 1:NP_524207.1 Gene:CycH / 40429 FlyBaseID:FBgn0022936 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_001370392.1 Gene:cit-1.1 / 176125 WormBaseID:WBGene00000507 Length:468 Species:Caenorhabditis elegans


Alignment Length:357 Identity:69/357 - (19%)
Similarity:131/357 - (36%) Gaps:107/357 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 WTFANEGQLMEFRVEQNSKYIESHEEEAQGRDLNEHFLTSAEERLLLKQYEIYLFDFCRRFEPTM 75
            |.|..|.......:::..    |.|||...|.:...|:....:.|...:            :|.|
 Worm    20 WLFTKEEMKKTASIQEGM----SREEELASRQMAAAFIQEMIDGLNNVK------------DPKM 68

  Fly    76 P-----KCVVGTAFHYFKRFYLNNSPMDYHPKEILATCVFVACKVEEFNVSINQFVN-------- 127
            .     .||..|..|   |||..:|...|..:::.|.|||:|.|.:|....::..::        
 Worm    69 KIGHTGLCVAHTHMH---RFYYLHSFKKYDYRDVGAACVFLAGKSQECPRKLSHVISVWRERKDR 130

  Fly   128 ---NIKGDRNKATDIVLSNELLLIGQLNYYLTIHNPFRPIEGFLIDIKTRSNMQNPDRLRPHIDS 189
               ..:..||:|..|::..|.:::..:.:.|.:|.|    ..:::||     |:..|: :.|...
 Worm   131 KQLTTETARNEAAQIIVLLESMILQTIAFDLNVHLP----HIYVLDI-----MKKVDK-KEHYRP 185

  Fly   190 FIDSTYY--------SDACLLHTPSQIALAAVLHAASREQENLDSYVTDLLFVS----------- 235
            .....||        :|..|.::.:.:::..:...|:.....::....|  |::           
 Worm   186 LTSCAYYFATDVIAVTDWSLRYSAASMSIVIIHLMAAYANVRIERLFAD--FINEDSPWYAKFDE 248

  Fly   236 --AREKLPGL-IDAV-----------------RKIRIMVKQYQQPDREKVKAIEKKLDKCRNQAN 280
              ..|||..: :|.:                 |:.|.|:   :.||       .:|||:.|:..:
 Worm   249 TMTNEKLREMEVDFLVTYRNSCQFHHASKFNFREHRPML---ENPD-------VRKLDRTRDARS 303

  Fly   281 N-------PDSELYKERLR-RLYTDEDDMPAE 304
            :       |||.:   .:| |.|...|::..|
 Worm   304 HSPMVHHVPDSTV---NVRPRAYVPRDELTVE 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycHNP_524207.1 ccl1 2..307 CDD:129660 69/357 (19%)
CYCLIN 63..>127 CDD:238003 18/68 (26%)
Cyclin_C_2 159..257 CDD:293504 20/136 (15%)
cit-1.1NP_001370392.1 CYCLIN_SF 19..160 CDD:424085 33/158 (21%)
CYCLIN_CCNT_rpt2 165..263 CDD:410242 17/109 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.