DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycH and cic-1

DIOPT Version :9

Sequence 1:NP_524207.1 Gene:CycH / 40429 FlyBaseID:FBgn0022936 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_497548.2 Gene:cic-1 / 175357 WormBaseID:WBGene00000506 Length:302 Species:Caenorhabditis elegans


Alignment Length:310 Identity:77/310 - (24%)
Similarity:141/310 - (45%) Gaps:53/310 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SSQKRSWTFANEGQLMEFRVEQNSKYIESHEEEAQGRDLN---EHFLTSAEERLLLKQYEIYLFD 66
            ||..:.|.| ::.::.:.|.|.    ::.:.||...| ||   .:|:|:........|..:    
 Worm     8 SSHCQQWIF-DKTEIWKQRAED----MKIYNEEEYNR-LNIFWANFITAVATEGAHSQANV---- 62

  Fly    67 FCRRFEPTMPKCVVGTAFHYFKRFYLNNSPMDYHPKEILATCVFVACKVEEF-NVSINQFVNNIK 130
            .|:     :.:.|:.||..|||||||..|..|..|..:.:|.:|:||||||. .:|::.|:.|..
 Worm    63 GCK-----LRQQVIATAIIYFKRFYLRQSFRDMCPFLVASTALFLACKVEEHTTLSVSSFLKNTA 122

  Fly   131 -------GDRNKATD----IVLSNELLLIGQLNYYLTIHNPFRPIEGFLIDIK------TRSN-- 176
                   |...:.|.    :|..:|.:|:..|:..|.:|:..||:...|.|:|      |.:|  
 Worm   123 IVLPKRWGVTFETTSTKNGVVYDSEFILVEILDCCLVVHHASRPMFELLEDLKQFTQQSTIANQP 187

  Fly   177 MQNPDRLRPHIDSFIDSTYYSDACLLHTPSQIALAAVLHAAS--REQENLDSYV----TDLLFVS 235
            :::.:.:........:.:...|..|:..|..|.|::::.|..  ...|.|::::    ||.    
 Worm   188 IKDLEAIEAQCQKVANDSLRCDVSLIFPPHVIGLSSIMVAMELMGRGEELEAWLVEVDTDF---- 248

  Fly   236 AREKLPGLIDAVRKIRIMVKQYQQPDREKVKAIEKKLDKCRNQANNPDSE 285
              ||:...::.:.|:..:.|.:.  ::|:||.:..||.| .||...|..:
 Worm   249 --EKVTDCVEQIYKMYTLWKSFD--EKEEVKKLMAKLPK-PNQQPPPQQQ 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycHNP_524207.1 ccl1 2..307 CDD:129660 77/310 (25%)
CYCLIN 63..>127 CDD:238003 24/64 (38%)
Cyclin_C_2 159..257 CDD:293504 21/111 (19%)
cic-1NP_497548.2 CYCLIN 64..>108 CDD:238003 20/48 (42%)
CYCLIN 162..261 CDD:294043 19/104 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 48 1.000 Domainoid score I8057
eggNOG 1 0.900 - - E1_COG5333
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.