DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycH and koko

DIOPT Version :9

Sequence 1:NP_524207.1 Gene:CycH / 40429 FlyBaseID:FBgn0022936 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_732338.1 Gene:koko / 14462485 FlyBaseID:FBgn0264816 Length:259 Species:Drosophila melanogaster


Alignment Length:241 Identity:48/241 - (19%)
Similarity:96/241 - (39%) Gaps:49/241 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 IYLFDFCR---RFEPTMPKCVVGTAFHYFKRFYLNNSPMDYHPKEILATCVFVACKV-EEFNVSI 122
            :|:|: |.   :.:|....| ....||   ||:......||....|.|..:::|.|: |:.:|.|
  Fly    38 MYIFE-CAAKLKMKPLTAAC-AAIVFH---RFFREVKASDYDEFLIAAGSLYLAGKIKEDESVKI 97

  Fly   123 NQFVN---------NIKGDRN----KATDIVLSNELLLIGQLNYYLTIHNPFRPIEGFLIDIK-- 172
            ...:|         |...|.|    ...|.::..|||:...|.:.|.|....:.:..::..::  
  Fly    98 RDVINVAYCTLNRGNDPVDLNDEYWSMRDAIVQAELLITRTLCFDLNIDLAHKYLLHYMKTLQDW 162

  Fly   173 TRSNMQNPDRLRPHIDSFIDSTYYSDACLLHTPSQIALAAVLHAASREQENLDSY-----VTDLL 232
            ..:.:.|...:.....|::...::|...|.:.|:.:|:..:..|       |.:|     :||..
  Fly   163 VGTEVWNSVPIAKAAASYLQDFHHSANILKYKPTHVAIGCLSLA-------LQTYGIQVPLTDES 220

  Fly   233 FVSAREKLPGLIDAVRKIRIMVKQYQQPDREKVKAIEKKLDKCRNQ 278
            ..||....|           :||.:.:.::.::  ||..::..:|:
  Fly   221 DESAMWYKP-----------LVKDFTRENQWEI--IENVIEVYKNE 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycHNP_524207.1 ccl1 2..307 CDD:129660 48/241 (20%)
CYCLIN 63..>127 CDD:238003 18/67 (27%)
Cyclin_C_2 159..257 CDD:293504 16/104 (15%)
kokoNP_732338.1 Cyclin_N 6..144 CDD:278560 27/110 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453873
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10026
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.