DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycH and Ccnt1

DIOPT Version :9

Sequence 1:NP_524207.1 Gene:CycH / 40429 FlyBaseID:FBgn0022936 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_033963.1 Gene:Ccnt1 / 12455 MGIID:1328363 Length:724 Species:Mus musculus


Alignment Length:354 Identity:71/354 - (20%)
Similarity:124/354 - (35%) Gaps:106/354 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SQKRSWTFANEGQLMEFRVEQNS---KYIESHEEEAQGRDLNEHFLTSAEERLLLKQYEIYLFDF 67
            :..:.|.|..| ||      :||   ::....::|...|....:.|....:||.:.|        
Mouse     7 NNNKRWYFTRE-QL------ENSPSRRFGVDSDKELSYRQQAANLLQDMGQRLNVSQ-------- 56

  Fly    68 CRRFEPTMPKCVVGTAFHYFKRFYLNNSPMDYHPKEILATCVFVACKVEEFNVSINQFV------ 126
                      ..:.||..|..|||:..|...:|...:....:|:|.||||....:...:      
Mouse    57 ----------LTINTAIVYMHRFYMIQSFTQFHRYSMAPAALFLAAKVEEQPKKLEHVIKVAHTC 111

  Fly   127 ----NNIKGDRNKA-----TDIVLSNELLLIGQLNYYLTIHNPFRPIEGFLIDIK-TRSNMQNPD 181
                .::...|::|     .|:|:. |.:::..|.:.|||.:|...:      :| |:....:.|
Mouse   112 LHPQESLPDTRSEAYLQQVQDLVIL-ESIILQTLGFELTIDHPHTHV------VKCTQLVRASKD 169

  Fly   182 RLRPHIDSFIDSTYYSDACLLHTPSQIALAAVLHAASREQ--------------ENLDSYVT-DL 231
            ..:.......:|.:.:...|.:||..:|...: |.|.:..              |.:|:.|| :|
Mouse   170 LAQTSYFMATNSLHLTTFSLQYTPPVVACVCI-HLACKWSNWEIPVSTDGKHWWEYVDATVTLEL 233

  Fly   232 L------FVSAREKLPGLIDAVRKIRIMVKQYQQPDREKVKAIEKKLDKCRNQANNPDSELYKER 290
            |      |:...||.|..:..:|..|    .||...:.|                 ||..     
Mouse   234 LDELTHEFLQILEKTPSRLKRIRNWR----AYQAAMKTK-----------------PDDR----- 272

  Fly   291 LRRLYTDEDDMPAEDASFH-IADVSSDTS 318
                  ..|:..:|....: |:..||||:
Mouse   273 ------GADENTSEQTILNMISQTSSDTT 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycHNP_524207.1 ccl1 2..307 CDD:129660 66/340 (19%)
CYCLIN 63..>127 CDD:238003 14/73 (19%)
Cyclin_C_2 159..257 CDD:293504 23/119 (19%)
Ccnt1NP_033963.1 Cyclin_N 13..149 CDD:278560 32/161 (20%)
Nuclear localization signal. /evidence=ECO:0000255 253..270 5/37 (14%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 483..586
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 691..724
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167839912
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.