DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycH and Ccnk

DIOPT Version :9

Sequence 1:NP_524207.1 Gene:CycH / 40429 FlyBaseID:FBgn0022936 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_033962.2 Gene:Ccnk / 12454 MGIID:1276106 Length:582 Species:Mus musculus


Alignment Length:189 Identity:46/189 - (24%)
Similarity:81/189 - (42%) Gaps:30/189 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 LTSAEERLLLKQYEIYLFDFCRRFEPTMPKCVVGTAFHYFKRFYLNNSPMDYHPKEIL-ATCVFV 111
            |..|.|....::...::||...|.  .:....:.|...||.|||:.:|...: |:.:. |.|:|:
Mouse    41 LDPATEARYRREGARFIFDVGTRL--GLHYDTLATGIIYFHRFYMFHSFKQF-PRYVTGACCLFL 102

  Fly   112 ACKVEEF----------------NVSINQFVNNIKGDRNKATDIVLSNELLLIGQLNYYLTIHNP 160
            |.||||.                :|...||     ||..|...:||  |.:|:..:.:.|.:.:|
Mouse   103 AGKVEETPKKCKDIIKTARSLLNDVQFGQF-----GDDPKEEVMVL--ERILLQTIKFDLQVEHP 160

  Fly   161 FRPIEGFLIDIKTRSNMQNPDRLRPHIDSFIDSTYYSDACLLHTPSQIALAAVLHAASR 219
            ::.:..:...:|...|  ...:|.....:|::.:..:...|...|..||: ||::.|.|
Mouse   161 YQFLLKYAKQLKGDKN--KIQKLVQMAWTFVNDSLCTTLSLQWEPEIIAV-AVMYLAGR 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycHNP_524207.1 ccl1 2..307 CDD:129660 46/189 (24%)
CYCLIN 63..>127 CDD:238003 22/80 (28%)
Cyclin_C_2 159..257 CDD:293504 13/61 (21%)
CcnkNP_033962.2 CCL1 25..>217 CDD:227640 46/189 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.