DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycH and Ccnc

DIOPT Version :9

Sequence 1:NP_524207.1 Gene:CycH / 40429 FlyBaseID:FBgn0022936 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_001093942.1 Gene:Ccnc / 114839 RGDID:70905 Length:283 Species:Rattus norvegicus


Alignment Length:298 Identity:78/298 - (26%)
Similarity:125/298 - (41%) Gaps:60/298 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SSQKRSWTFANEGQLMEFRVEQNSKYIESHEEEAQGRDLNEHFLTSAEERLLLKQYEIYLFDFCR 69
            ||....|....:..|.|  .:::.|:: |.||..:.:....:.:.:..|.|.|:|.         
  Rat     8 SSHYLQWILDKQDLLKE--RQKDLKFL-SEEEYWKLQIFFTNVIQALGEHLKLRQQ--------- 60

  Fly    70 RFEPTMPKCVVGTAFHYFKRFYLNNSPMDYHPKEILATCVFVACKVEEFNVSIN----------- 123
                     |:.||..||||||...|.....|..:..||||:|.|||||.|..|           
  Rat    61 ---------VIATATVYFKRFYARYSLKSIDPVLMAPTCVFLASKVEEFGVVSNTRLIAATTSVL 116

  Fly   124 --QFVNNIKGDRNKATDIVLSNELLLIGQLNYYLTIHNPFRPIEGFLIDIKTRSNMQNPDRLRPH 186
              :|......:.....:.:|..|..|:..::..|.:::|:||:..::.|      |...|.|.|.
  Rat   117 KTRFSYAFPKEFPYRMNHILECEFYLLELMDCCLIVYHPYRPLLQYVQD------MGQEDVLLPL 175

  Fly   187 IDSFIDSTYYSDACLLHTPSQIALAAVLHAASREQENLDSYVTDLLFVSAREKLPGLIDAVRK-- 249
            ....::.||.:|.|||:.|..||||. ||.|...|:.           .||:....|...:.|  
  Rat   176 AWRIVNDTYRTDLCLLYPPFMIALAC-LHVACVVQQK-----------DARQWFAELSVDMEKIL 228

  Fly   250 --IRIMVKQYQQ----PDREKVKAIEKKLDKCRNQANN 281
              ||:::|.|:|    .:|:::..|..|:.|.:...|:
  Rat   229 EIIRVILKLYEQWKNFDERKEMATILSKMPKPKPPPNS 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycHNP_524207.1 ccl1 2..307 CDD:129660 78/298 (26%)
CYCLIN 63..>127 CDD:238003 24/76 (32%)
Cyclin_C_2 159..257 CDD:293504 30/101 (30%)
CcncNP_001093942.1 CYCLIN_CCNC_rpt1 40..146 CDD:410217 31/123 (25%)
CYCLIN_CCNC_rpt2 154..245 CDD:410218 32/108 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5333
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.