DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycH and Ccnl1

DIOPT Version :9

Sequence 1:NP_524207.1 Gene:CycH / 40429 FlyBaseID:FBgn0022936 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_446114.1 Gene:Ccnl1 / 114121 RGDID:620864 Length:527 Species:Rattus norvegicus


Alignment Length:257 Identity:58/257 - (22%)
Similarity:108/257 - (42%) Gaps:56/257 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 MPKCVVGTAFHYFKRFYLNNSPMDYHPKEILA-TCVFVACKVEEFNVSINQFVN------NIKGD 132
            :|:..:.|....|.||:.:.|.:. |..||:| .|:.:|.|:||....|...:|      .::|.
  Rat   100 LPQVAMATGQVLFHRFFYSKSFVK-HSFEIVAMACINLASKIEEAPRRIRDVINVFHHLRQLRGK 163

  Fly   133 RNKATDI-----------VLSNELLLIGQLNYYLTIHNPFRPIEGFL---------IDIKTRSNM 177
            |..:..|           |:..|..::.:|.:.:.:.:|.:.|..:|         ..::|..|.
  Rat   164 RTPSPLILDQNYINTKNQVIKAERRVLKELGFCVHVKHPHKIIVMYLQVLECERNQTLVQTAWNY 228

  Fly   178 QNPDRLRPHIDSFIDSTYYSDACLLHTPSQIALAAVLHAASREQENLDSYV-TDLLFVSAREKLP 241
            .| |.||.::  |:          ...|..||.|.:..||...|..|.:.. ..|||.:..|::.
  Rat   229 MN-DSLRTNV--FV----------RFQPETIACACIYLAARALQIPLPTRPHWFLLFGTTEEEIQ 280

  Fly   242 GLIDAVRKIRIMVKQYQQPDREKVKAIEKKLDKCRNQANNPDSELYKERLRRLYTDEDDMPA 303
            .:  .:..:|:..:  ::|:.|   .:||:::| |..|      |.:.:|:....:.|..||
  Rat   281 EI--CIETLRLYTR--KKPNYE---LLEKEVEK-RKVA------LQEAKLKAKGLNLDGTPA 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycHNP_524207.1 ccl1 2..307 CDD:129660 58/257 (23%)
CYCLIN 63..>127 CDD:238003 16/52 (31%)
Cyclin_C_2 159..257 CDD:293504 23/107 (21%)
Ccnl1NP_446114.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..37
CYCLIN_SF 41..196 CDD:424085 23/96 (24%)
Cyclin-like 1 89..191 22/91 (24%)
CYCLIN_SF 200..322 CDD:424085 32/148 (22%)
Cyclin-like 2 204..288 21/98 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 327..527 2/2 (100%)
RS 391..433
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343761
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5333
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.