DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eg and Pgr

DIOPT Version :10

Sequence 1:NP_524206.1 Gene:eg / 40428 FlyBaseID:FBgn0000560 Length:373 Species:Drosophila melanogaster
Sequence 2:NP_074038.2 Gene:Pgr / 25154 RGDID:3317 Length:926 Species:Rattus norvegicus


Alignment Length:172 Identity:49/172 - (28%)
Similarity:73/172 - (42%) Gaps:42/172 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 QLCKVCGEPAAGFHFGAFTCEGCKSFFGRTYNNIAAIAG-----CKHNGDCVINKKNRTACKACR 62
            ::|.:||:.|:|.|:|..||..||.||.|      |:.|     |....||:::|..|..|.|||
  Rat   558 KICLICGDEASGCHYGVLTCGSCKVFFKR------AMEGQHNYLCAGRNDCIVDKIRRKNCPACR 616

  Fly    63 LRKCLLVGMSKSGSRYGRRSNWFKIHCLLQEQQTTSGLGGGSSVGSGSGGGVSSASLEQLARLQQ 127
            ||||...||...|.:: ::.|..::      .:...|:....|||..:    .|.:|.|  |:..
  Rat   617 LRKCCQAGMVLGGRKF-KKFNKVRV------MRALDGVALPQSVGLPN----ESQTLGQ--RITF 668

  Fly   128 ASNQARQTY------------------QDKTNPCIKSATATT 151
            :.||..|..                  .|.|.|...|:..|:
  Rat   669 SPNQEIQLVPPLINLLMSIEPDVVYAGHDNTKPDTSSSLLTS 710

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
egNP_524206.1 NR_DBD_like 3..87 CDD:413390 33/88 (38%)
PgrNP_074038.2 Prog_receptor 1..557 CDD:460470
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..49
LXXL motif 1. /evidence=ECO:0000250|UniProtKB:P06401 56..60
LXXL motif 2. /evidence=ECO:0000250|UniProtKB:P06401 116..120
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 153..240
Mediates transcriptional transrepression (in isoform A). /evidence=ECO:0000250|UniProtKB:P06401 166..305
Nuclear localization signal. /evidence=ECO:0000255 185..189
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 334..372
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 413..436
AF1, mediates transcriptional activation. /evidence=ECO:0000250|UniProtKB:P06401 453..539
NR_DBD_GR_PR 556..633 CDD:143546 32/81 (40%)
NR_LBD_PR 679..926 CDD:132759 5/32 (16%)
AF2, mediates transcriptional activation. /evidence=ECO:0000250|UniProtKB:P06401 680..926 5/31 (16%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.