DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment eg and Vdr

DIOPT Version :9

Sequence 1:	NP_524206.1	Gene:	eg / 40428	FlyBaseID:	FBgn0000560	Length:	373	Species:	Drosophila melanogaster
Sequence 2:	NP_033530.2	Gene:	Vdr / 22337	MGIID:	103076	Length:	422	Species:	Mus musculus

Alignment Length:	71	Identity:	38/71 - (53%)
Similarity:	48/71 - (67%)	Gaps:	1/71 - (1%)

- Green bases have known domain annotations that are detailed below.

  Fly     3 QLCKVCGEPAAGFHFGAFTCEGCKSFFGRTYNNIAAIAGCKHNGDCVINKKNRTACKACRLRKCL 67
            ::|.|||:.|.||||.|.||||||.||.|:... .|:..|..||||.|.|.||..|:||||::|:
Mouse    22 RICGVCGDRATGFHFNAMTCEGCKGFFRRSMKR-KALFTCPFNGDCRITKDNRRHCQACRLKRCV 85

  Fly    68 LVGMSK 73
            .:||.|
Mouse    86 DIGMMK 91

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
eg	NP_524206.1	NR_DBD_like	3..87	CDD:295381	38/71 (54%)
Vdr	NP_033530.2	NR_DBD_VDR	16..122	CDD:143513	38/71 (54%)
		Hinge	97..126
		NR_LBD_VDR	124..421	CDD:132731
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	161..185
		Vitamin D3 binding. /evidence=ECO:0000250	222..232
		Interaction with coactivator LXXLL motif. /evidence=ECO:0000250	241..259
		Vitamin D3 binding. /evidence=ECO:0000250	266..273
		9aaTAD. /evidence=ECO:0000250\|UniProtKB:P11473	411..419
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	1	0.950	-	0	Normalized mean entropy	S6132
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	2	1.860