powered by:
Protein Alignment eg and nhr-231
DIOPT Version :9
Sequence 1: | NP_524206.1 |
Gene: | eg / 40428 |
FlyBaseID: | FBgn0000560 |
Length: | 373 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_507672.2 |
Gene: | nhr-231 / 189445 |
WormBaseID: | WBGene00012449 |
Length: | 397 |
Species: | Caenorhabditis elegans |
Alignment Length: | 73 |
Identity: | 25/73 - (34%) |
Similarity: | 37/73 - (50%) |
Gaps: | 1/73 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 5 CKVCGEPAAGFHFGAFTCEGCKSFFGRTYNNIAAIAGCKHNGDCVINKKNRTACKACRLRKCLLV 69
|::|.:...|.|||..||..|.:||.||..........:.:|.|.:..:..| ||.||.:||:.:
Worm 17 CEICQKTGHGHHFGLETCRACAAFFRRTVVLNRKYKCAQKSGKCDVGAEKAT-CKFCRYKKCIDL 80
Fly 70 GMSKSGSR 77
||:....|
Worm 81 GMTTDNVR 88
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1136195at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.010 |
|
Return to query results.
Submit another query.