DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eg and nhr-208

DIOPT Version :9

Sequence 1:NP_524206.1 Gene:eg / 40428 FlyBaseID:FBgn0000560 Length:373 Species:Drosophila melanogaster
Sequence 2:NP_506034.2 Gene:nhr-208 / 187662 WormBaseID:WBGene00011099 Length:410 Species:Caenorhabditis elegans


Alignment Length:81 Identity:33/81 - (40%)
Similarity:44/81 - (54%) Gaps:3/81 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 CKVCGEPAAGFHFGAFTCEGCKSFFGRTYNNIAAIAGCKHNGDCVINK--KNRTACKACRLRKCL 67
            |::||.||.|:|:...:|.|||:||.||......:| ||..|.|:..:  .||..|..||..||:
 Worm    43 CEICGNPAIGYHYDIASCNGCKAFFRRTVITGRQVA-CKKWGTCLEEEIPINRRICPGCRFSKCV 106

  Fly    68 LVGMSKSGSRYGRRSN 83
            .|||:....|....||
 Worm   107 KVGMNPRAIRAEISSN 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
egNP_524206.1 NR_DBD_like 3..87 CDD:295381 33/81 (41%)
nhr-208NP_506034.2 ZnF_C4 42..112 CDD:197701 30/69 (43%)
HOLI 216..376 CDD:214658
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AR2M
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.