DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eg and nhr-125

DIOPT Version :9

Sequence 1:NP_524206.1 Gene:eg / 40428 FlyBaseID:FBgn0000560 Length:373 Species:Drosophila melanogaster
Sequence 2:NP_504194.2 Gene:nhr-125 / 187520 WormBaseID:WBGene00003715 Length:399 Species:Caenorhabditis elegans


Alignment Length:78 Identity:30/78 - (38%)
Similarity:41/78 - (52%) Gaps:6/78 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 CKVCGEPAAGFHFGAFTCEGCKSFFGRTYNNIAAIAGCKHNGDCVINKKNRTACKACRLRKCLLV 69
            |::|.:.|.|.|||..||..|.|||.|...:..:...|: .|.|     :|..||.|||:||..:
 Worm    13 CRICNQKAHGNHFGVLTCRACASFFRRAAFSKWSQLKCQ-KGGC-----SRNFCKRCRLKKCREM 71

  Fly    70 GMSKSGSRYGRRS 82
            ||..:..:|.|.|
 Worm    72 GMDTTKFQYNRDS 84

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
egNP_524206.1 NR_DBD_like 3..87 CDD:295381 30/78 (38%)
nhr-125NP_504194.2 ZnF_C4 13..74 CDD:197701 26/66 (39%)
Hormone_recep 165..360 CDD:278530
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1136195at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.