DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14564 and CG14572

DIOPT Version :9

Sequence 1:NP_649361.1 Gene:CG14564 / 40425 FlyBaseID:FBgn0037131 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_649359.1 Gene:CG14572 / 40422 FlyBaseID:FBgn0037128 Length:257 Species:Drosophila melanogaster


Alignment Length:252 Identity:67/252 - (26%)
Similarity:94/252 - (37%) Gaps:66/252 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 QPILILAVCLLALSAVSAMPQRRAKSQRQVEYSST----------PYPAAGFRPR-VPFNLPGEV 57
            |.||.:.:||.|||.|    |..|:..|...|:.|          ||||||:||: ..|.||.||
  Fly     2 QSILPVILCLWALSPV----QIEARQVRINRYAVTVQEDQPAEDAPYPAAGYRPQGRSFWLPSEV 62

  Fly    58 QPKIETEPLTTTSTTSASEVETLE----NTEPLSTTEQQQPEAGTVADLELSIRTPAN------T 112
            :.::...|       .|.|.|..|    .|..|:||.:...|     ||..|...|.:      .
  Fly    63 EVEVIEGP-------GAVEAEVQEGSGLGTNQLTTTTELPLE-----DLSTSTTDPTDDWSTTTN 115

  Fly   113 YGAPEEQDPLVPDTVVVVAQ---------------EPARDFQPPSLDAVE-----------DFAA 151
            :|:.:....| |.|:.|.::               .|:|.|:.|:..:.|           |..|
  Fly   116 WGSVDTSTAL-PATLAVESRTGRAFVKAPYPPAGYRPSRAFRLPTEQSREEEQKTSSSNSTDSNA 179

  Fly   152 DVTVAADGEQPVADVPALGQAESEDDEPEAAVKAVTPA--GAYGPPAATYGVPELSE 206
            |..|......|:...|..|..:..|.|.......|.||  .|..|.:....:|..|:
  Fly   180 DHPVCGVSTDPLKPTPEPGSKDEPDSESVVFTANVGPAVVVARVPSSIPVAIPLRSQ 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14564NP_649361.1 DUF4794 37..116 CDD:292661 29/99 (29%)
CG14572NP_649359.1 DUF4794 142..>164 CDD:292661 4/21 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456994
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.