DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syn1 and CYTIP

DIOPT Version :9

Sequence 1:NP_001262192.1 Gene:Syn1 / 40424 FlyBaseID:FBgn0037130 Length:627 Species:Drosophila melanogaster
Sequence 2:NP_004279.3 Gene:CYTIP / 9595 HGNCID:9506 Length:359 Species:Homo sapiens


Alignment Length:405 Identity:82/405 - (20%)
Similarity:132/405 - (32%) Gaps:124/405 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 NGTLPNSASLQGMNIQDTELDGSASNDNGDRDPCLNNNNNAGDGGGMDMC-----DVPDHVANQK 162
            ||.|.:..:....:...| |.||.:.|:..|...|.:.......|...:.     .:.|...:|:
Human    12 NGNLADFCAGPAYSSYST-LTGSLTMDDNRRIQMLADTVATLPRGRKQLALTRSSSLSDFSWSQR 75

  Fly   163 RHVRIIKSDNNGLGISIKGGR-------ENRMPILISKIFRGMAADQAKGLYVGDAILTVNGEEL 220
            :.|.:.|.||...|..|:..|       .:.|..||.||.....|..| ||..||.:..:||...
Human    76 KLVTVEKQDNETFGFEIQSYRPQNQNACSSEMFTLICKIQEDSPAHCA-GLQAGDVLANINGVST 139

  Fly   221 RDATHDEAVRALKRSGRVVDLEV---KFLREVTPYFRKASIISEV---GW------ELQR----- 268
            ...|:.:.|..::.||.::.:|.   ..:.:.|....|..::.:.   .|      :||.     
Human   140 EGFTYKQVVDLIRSSGNLLTIETLNGTMILKRTELEAKLQVLKQTLKQKWVEYRSLQLQEHRLLH 204

  Fly   269 --AFLCP---------LGPGVPTSPPAPKTTPRADTRYIPLQLTHLARNLKYIDPENRC------ 316
              |..||         |....|...|.|....|                 ..:..|:.|      
Human   205 GDAANCPSLENMDLDELSLFGPLPGPGPALVDR-----------------NRLSSESSCKSWLSS 252

  Fly   317 FELHSPDGVHSCILRAADSAEALVWFNALHSAMGTST--------------QRALAEANRALTNL 367
            ..:.|.||..:|:  :.||:....       :..|||              :|:.:..||:::|.
Human   253 MTMDSEDGYQTCV--SEDSSRGAF-------SRQTSTDDECFIPKEGDDFLRRSSSRRNRSISNT 308

  Fly   368 IGELKHIGWLSKRMSGGGSSGSAGGGAASGGSGTSNSVVAGELVSPSG---RSSSESSDESD--K 427
                                          .||:.:.:..|.|.|..|   |.|.:.|....  |
Human   309 ------------------------------SSGSMSPLWEGNLSSMFGTLPRKSRKGSVRKQLLK 343

  Fly   428 WLP-IFVAVTEREFR 441
            ::| :..||.|.|.|
Human   344 FIPGLHRAVEEEESR 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syn1NP_001262192.1 PH-like 30..>61 CDD:302622
PDZ_signaling 163..244 CDD:238492 25/90 (28%)
PHsplit_syntrophin <293..351 CDD:269960 8/63 (13%)
CYTIPNP_004279.3 PDZ_signaling 76..161 CDD:238492 24/85 (28%)
Interaction with CYTH1 166..188 2/21 (10%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.