powered by:
Protein Alignment Syn1 and pdzd3a
DIOPT Version :9
Sequence 1: | NP_001262192.1 |
Gene: | Syn1 / 40424 |
FlyBaseID: | FBgn0037130 |
Length: | 627 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_685398.3 |
Gene: | pdzd3a / 557269 |
ZFINID: | ZDB-GENE-080430-1 |
Length: | 520 |
Species: | Danio rerio |
Alignment Length: | 59 |
Identity: | 20/59 - (33%) |
Similarity: | 35/59 - (59%) |
Gaps: | 1/59 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 183 RENRMPILISKIFRGMAADQAKGLYVGDAILTVNGEELRDATHDEAVRALKRSGRVVDL 241
|..|:..::.:|.....|:.| |:..|:.:|.||||::.||.|:..|..:::||:.|.|
Zfish 303 RSGRIAHILREIDPCSPAETA-GMEDGEIVLAVNGEQVEDAEHEGIVSKIRQSGQQVTL 360
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3528 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.